DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Qsox2 and Qsox4

Sequence 1:NP_650998.1 Gene:Qsox2 FlyBaseID:FBgn0038919 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_732891.1 Gene:Qsox4 FlyBaseID:FBgn0051413 Length:561 Species:Drosophila melanogaster

Alignment Length:573 Identity:217/574 (38%)
Similarity:324/574 (56%) Gaps:64/574 (11%)


  Fly     7 TLLYCLLLISPADVLGRLNARKSANEASLYSDTDNVIMLDIESLRPALNLKNS-KLVQFLNSFCG 70
            :||.|:|::|..  .|.|          |::..|||:.||..|....|:...| |||||.|.||.
  Fly    11 SLLLCVLILSAG--RGEL----------LFNADDNVVQLDFASFESGLSEPTSGKLVQFFNGFCE 63

  Fly    71 DCHRFAPVFKTLSRDLYKWRRILRIYAVDCAQERNAQLCREFNIRQTPSLRFFGPDMRKNDDVLG 135
            :...|.|.||.|||.||||.|:|:::.:||.::.|..:|..::||:||:||:|.|..:...|.||
  Fly    64 ESQNFIPAFKNLSRKLYKWHRLLKVHVLDCGKDENDMICSIYSIRKTPTLRYFPPSYKLAPDNLG 128

  Fly   136 AVIPGQDPEFISSTLAELVSQNDYGPGQPNFRPLKATD--YEIFQDQDGETPIQFVALVLQ---- 194
            ..|..::|:.|.|.||..:.:.||      |:..|..|  ..|||.   ...|::||.|.|    
  Fly   129 TEITHRNPKEIQSKLALNLQKLDY------FKMFKRQDNVAHIFQT---HKDIEYVAFVFQMCLD 184

  Fly   195 --------------------------PKNSKIGRDTLLELLPFKELSVRIIEDSQIFNEFGLGPD 233
                                      |..|.|||:|||||||::::.|||.::..::|:||:.|.
  Fly   185 HFLPHLETGNSMEEKYASQGDCNEDNPIVSLIGRNTLLELLPYRKVVVRIFDNHDVYNKFGISPV 249

  Fly   234 DQKLAIVDRNGTAQYLTPSSDSSEAYASTIGDFLKNRNIQPDPPLPIAVAPNFTEFLDHQNQAIL 298
            ...:.:|::.|...:|||..|||:||.:.|..||...:::|..|||.....|.:|.|.::   |.
  Fly   250 PNLVVLVNKAGKLLFLTPEMDSSKAYVAAIKQFLIFVDLKPQKPLPKTPPANISEALRYE---IF 311

  Fly   299 TKVLTPPLQVYRADLEQAIDKLLHIELRKWVLLEGNSLNALKNIIKIFRYLNPLNKDGKLLLTDL 363
            .:....|.::||||||:|||::|:::........|..:..|:|.:|:....:||..:.:..|.:|
  Fly   312 EQHKHHPSRIYRADLERAIDQILNVKFPGTTHFAGAKIVVLRNFVKLIYNSSPLKPEAREKLANL 376

  Fly   364 DNSLSSKQSIKGADFGD-LVDSLENGRRVFKARRYVGCIGSRPLLRSFTCSMWTLFHHLTVEAAK 427
            ..||..|:.:.|..|.: |:.|:::  .||..::|||||.|||.||.|.||:|.|||:|:||:.|
  Fly   377 YYSLHVKKQLSGVGFKNLLLKSVKD--YVFDGKQYVGCIASRPSLRGFNCSLWVLFHYLSVESKK 439

  Fly   428 PPNYFEAGSILKTFHGFAKYFFGCTDCSEHFQQMAIRRNLTSVKTHDEEILWLWAAHNEVNARIA 492
                .:..|:|..|.|:.::|..|.:|.....:....|.:.:|...||:|||||.|||.||.::|
  Fly   440 ----LKPKSVLLVFLGYVRFFMNCKECDMKISEFKKLRPIANVTNDDEQILWLWEAHNYVNKQLA 500

  Fly   493 GDSTEDPKFPKIQFPSAENCPTCRSNDSEWRTDEVLKYLKQLYDINNVSFYGL 545
            ||||||||||||||||..:||.||:|.:||||:|||.|||.:|.:.|:|::|:
  Fly   501 GDSTEDPKFPKIQFPSERDCPKCRNNATEWRTEEVLHYLKGIYTLKNLSWFGM 553

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Qsox2NP_650998.1 PDI_a_QSOX 40..152 CDD:239290 50/113 (44%)
Evr1_Alr 413..504 CDD:282612 42/91 (46%)
Qsox4NP_732891.1 PDI_a_QSOX 32..145 CDD:239290 50/113 (44%)
Evr1_Alr 425..512 CDD:282612 42/91 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131143052
eggNOG 1 0.900 E1_KOG1731
Homologene 1 1.000 H65608
Inparanoid 1 1.050 163 1.000 Inparanoid score I1564
Isobase 1 0.950 0 Normalized mean entropy S4773
OrthoDB 1 1.010 D158783at33208
OrthoFinder 1 1.000 FOG0001145
orthoMCL 1 0.900 OOG5_129038
Panther 1 1.100 P PTHR22897
RoundUp 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.