DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Qsox2 and Qsox2

Sequence 1:NP_650998.1 Gene:Qsox2 FlyBaseID:FBgn0038919 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001289885.1 Gene:Qsox2 MGIID:2387194 Length:692 Species:Mus musculus

Alignment Length:567 Identity:166/568 (29%)
Similarity:277/568 (49%) Gaps:62/568 (11%)


  Fly     5 LKTLLYCLLLISPADVLGRLNARKSANEASLYSD-TDNVIMLDIESLRPAL-NLKNSKLVQFLNS 67
            |..||:.|.:::..       ..:....|.||.: :|.|.:||..|:|.|. |...:.||||.:|
Mouse    26 LPRLLFLLAVVAAV-------GPREGGGARLYREGSDAVWLLDSGSVRSATGNSSAAWLVQFHSS 83

  Fly    68 FCGDCHRFAPVFKTLSRDLYKWRRILRIYAVDCAQERNAQLCREFNIRQTPSLRFFGPDMRKNDD 132
            :||.|..:||.::.|:.|:..|...:|:.|:|||:|:|..:||.::|...|:.|:|....:  :.
Mouse    84 WCGHCIGYAPTWRALAADVRDWAAAIRVAALDCAEEKNQDVCRTYDIHFYPTFRYFKAFTK--EF 146

  Fly   133 VLGAVIPGQDPEF--ISSTLAELVSQNDYG---PGQPNFRPLKATDYEIFQDQDGETPIQFVALV 192
            ..|....|.|.|.  :..|:.:.:..:..|   |..|...|::::|...|.|....   |:.|:|
Mouse   147 TTGENFKGPDRELRTVRQTMIDFLQNHTEGTWPPACPPLDPIQSSDILSFMDSHSG---QYHAIV 208

  Fly   193 LQPKNSKIGRDTLLELLPFKELSV-RIIEDSQIFNEFGLG-------PDDQKLAIVDRNGTAQYL 249
            .:...|.:||:.:|:|:|::.:.| |.::..:.|    ||       |....:.....:|.....
Mouse   209 FESNGSYVGREVILDLIPYENIMVSRALDTDKAF----LGTLGITSVPSCYLIYPNGSHGLVNVA 269

  Fly   250 TPSSDSSEAYASTIGDFLKNRNIQPDPPLPIAVAPNFTEFLDHQNQAILTKVLTPPLQVYRADLE 314
            .|......::..::.|..|.....|:           ....:.:::.::.|.. ...::|.||||
Mouse   270 KPLRSFFSSHLKSLPDVRKKSLFLPE-----------KSNKEEKSEVVVWKEF-DRAKLYTADLE 322

  Fly   315 QAIDKLLHIELRKWVLLEGNSLNALKNIIKIFRYLNPLNKDGKLLLTDLDNSLSSKQSIKGADFG 379
            ..:..||.:||.....|.|..|...::.:.:...|.|.....|.||..|...|::....| ..:.
Mouse   323 SGLHYLLRVELAAHRSLAGAQLKTFRDFVTVVAKLFPGRPAVKKLLETLQEWLANLPLDK-IPYN 386

  Fly   380 DLVDSLENGRR---VFKAR--RYVGCIGSRPLLRSFTCSMWTLFHHLTVEAAKPPNY-----FEA 434
            .::|.:.|..:   :|...  ::|||.|||..||.:.||:|.|||.|||:|:..|..     ||.
Mouse   387 AILDLVNNKMQISGIFLTSHVKWVGCQGSRLELRGYPCSLWKLFHTLTVQASTHPEALAGTGFEG 451

  Fly   435 --GSILKTFHGFAKYFFGCTDCSEHFQQMAIRRNLTSVKTHDEEILWLWAAHNEVNARIAGDSTE 497
              .::|:....:.:.||||.:|.|||::|| :.::.||||.|:.:||||..||.||:|:||..:|
Mouse   452 HPQAVLQAIRRYIRTFFGCKECGEHFEEMA-KESMDSVKTPDQAVLWLWRKHNMVNSRLAGHLSE 515

  Fly   498 DPKFPKIQFPSAENCPTCRSN----DSEWRTDEVLKYLKQLYDINNV 540
            ||||||:.:|:.:.||.|...    || |...:||.:|||.|..:|:
Mouse   516 DPKFPKVPWPTPDLCPACHEEIKGLDS-WNEGQVLLFLKQHYSRDNL 561

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Qsox2NP_650998.1 PDI_a_QSOX 40..152 CDD:239290 39/115 (34%)
Evr1_Alr 413..504 CDD:282612 46/98 (47%)
Qsox2NP_001289885.1 PDI_a_QSOX 55..168 CDD:239290 40/117 (34%)
Evr1_Alr 425..522 CDD:282612 47/104 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2478542
eggNOG 1 0.900 E1_KOG1731
Hieranoid 1 1.000
Homologene 1 1.000 H65608
Inparanoid 1 1.050 267 1.000 Inparanoid score I3001
Isobase 1 0.950 0 Normalized mean entropy S4773
OMA 1 1.010
OrthoDB 1 1.010 D158783at33208
OrthoFinder 1 1.000 FOG0001145
OrthoInspector 1 1.000 T130964
orthoMCL 1 0.900 OOG5_129038
Panther 1 1.100 O PTHR22897
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3816
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.