DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Qsox2 and F47B7.2

Sequence 1:NP_650998.1 Gene:Qsox2 FlyBaseID:FBgn0038919 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_508652.1 Gene:F47B7.2 WormBaseID:WBGene00018533 Length:678 Species:Caenorhabditis elegans

Alignment Length:573 Identity:150/574 (26%)
Similarity:256/574 (45%) Gaps:64/574 (11%)


  Fly     8 LLYCLLLISPADVLGRLNARKSANEASLYSDTDNVIMLDIESLRPAL-NLKNSKLVQFLNSFCGD 71
            :|:.|::|.      ..:|..|:.| |||...|.::.||:::...|: ..|.:..::|.:|:||.
 Worm    23 MLFILVVIL------AFSAGGSSGE-SLYDKDDPILELDVDTFSAAIYGSKKAHFIEFYSSWCGA 80

  Fly    72 CHRFAPVFKTLSRDLYKWRRILRIYAVDCAQERNAQLCREFNIRQTPSLRFFGPDMRKNDDVLGA 136
            |..:||.||..::.|.||..::::..|:||.::|..||||.::...||||:|..:....||  |.
 Worm    81 CIGYAPTFKKFAKQLEKWAPLVQVTVVNCADDKNMPLCREHSVSSYPSLRYFKYNSHNKDD--GM 143

  Fly   137 VIPGQDPEFIS-----STLAELVSQNDYGPGQPNFRPLKATD--YEIFQDQDGETPIQFVALVLQ 194
            ...|...:...     :.||:..:|.......|.|.||..|.  .|:|: ..|.|  .::|:|:|
 Worm   144 KYSGDKYDINKLAHDIAGLAQADAQKQNPESWPTFLPLSDTTTLEEVFK-SIGTT--SYLAIVVQ 205

  Fly   195 PKNSKIGRDTLLELLPFKELSVRIIED-----SQIFNEFGLGPDDQKLAIVDRNGTAQYLTPSS- 253
            ...|.|....|:.......:.|..:..     ::.|::.|:.      |::..||..:.|..|| 
 Worm   206 DSPSVIAWANLINYHGNNGVKVAYVTQNHPIATKFFSDGGVH------ALLFSNGNQEPLWKSSS 264

  Fly   254 ------DSSEAYASTIGDFL--KNRNIQPDPPLPIAVAPNFTEFLDHQNQAILTKVLTPPLQVYR 310
                  |..:.....|||.:  ....:.|....|:..||              :..|....:|..
 Worm   265 PVDKWVDVQDKIDELIGDKIAASGPTVHPINAAPVIAAP--------------SNPLNNQYEVQL 315

  Fly   311 ADLEQAIDKLLHIELRKWVLLEGNSLNALKNIIKIFRYLNPLNKDGKLLLTDLDNSLSSKQSIKG 375
            .||:.|:..:|:.|:.:...:....:..||..:...:...|.....:.|...||..:..:..:..
 Worm   316 VDLKSAMSYMLYKEIPRREEIRDEPMAVLKQWMHTLKKYAPGTTPMRRLFFRLDEWIQLQSVVTA 380

  Fly   376 ADFGDLVDSLEN--GRRVFKARRYVGCIGSRPLLRSFTCSMWTLFHHLTVEAAKPPNYFEAG--- 435
            .::...||.::.  |..:.|...::.|.||:|.||.:||.:|||.|.:||||.|...:..|.   
 Worm   381 NEWITKVDEIQQALGNPLPKEITWMACAGSKPNLRGYTCGLWTLAHTITVEAYKQEKHNTAFKPV 445

  Fly   436 -SILKTFHGFAKYFFGCTDCSEHFQQMAIRRNLTSVKTHDEEILWLWAAHNEVNARIAGDSTEDP 499
             .:|:.|..|..:|..|::|:::|.:.|.:..|..|...::...|||..||.||.|::|..|:||
 Worm   446 IDVLEPFRAFIFHFLSCSECAQNFTKEAEKNQLHLVTRPEDVYAWLWRVHNFVNKRLSGSLTDDP 510

  Fly   500 KFPKIQFPSAENCPTCRSNDSEWRTDEVLKYLKQLY-DINNVSFYGLPTPQGY 551
            .|.|.|||....|..|...:.:....:.|.::.:.| :|...|...||   ||
 Worm   511 SFKKQQFPPKSLCADCYDANGDIDEAKALPFVFKYYSNIKTDSTDNLP---GY 560

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Qsox2NP_650998.1 PDI_a_QSOX 40..152 CDD:239290 36/118 (31%)
Evr1_Alr 413..504 CDD:282612 34/95 (36%)
F47B7.2NP_508652.1 PDI_a_QSOX 48..161 CDD:239290 34/115 (30%)
PSRP-3_Ycf65 <357..>391 CDD:296659 5/34 (15%)
Evr1_Alr 420..514 CDD:282612 33/94 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1731
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 221 1.000 Inparanoid score I2244
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D158783at33208
OrthoFinder 1 1.000 FOG0001145
OrthoInspector 1 1.000 T98024
orthoMCL 1 0.900 OOG5_129038
Panther 1 1.100 O PTHR22897
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3816
TreeFam 1 0.960
1110.860

Return to query results.
Submit another query.