DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Qsox2 and T10H10.2

Sequence 1:NP_650998.1 Gene:Qsox2 FlyBaseID:FBgn0038919 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_508419.1 Gene:T10H10.2 WormBaseID:WBGene00020426 Length:574 Species:Caenorhabditis elegans

Alignment Length:581 Identity:154/582 (26%)
Similarity:241/582 (41%) Gaps:118/582 (20%)


  Fly    12 LLLISP--ADVLGRLNARKSANEASLYSDTDNVIMLDIESLRPALNLKNS----KLVQFLNSFCG 70
            :|||:|  ||:.......|.|| .:|||..|:|:.||..:....:....|    .||:|.:.:||
 Worm     5 ILLITPVLADIATYGYHPKGAN-PTLYSPEDSVLQLDEATFNDTIFGAQSGAAGYLVEFYSDWCG 68

  Fly    71 DCHRFAPVFKTLSRDLYKWRRILRIYAVDCAQERNAQLCREFNIRQTPSLRFFGPDMRKNDDVLG 135
            .|..|||.:|.|::|:..|:.|::|.|::||...|..:||...:|..|.:::|..|...:.:  |
 Worm    69 HCRAFAPTYKNLAKDVDGWQNIVKIAAINCADPVNEPVCRSNGVRFFPLIKYFPRDSLNSTE--G 131

  Fly   136 AVIPGQDPEFISSTLAELVSQ------NDYG----PGQPNFRPLK--ATDYEIFQDQDGETPIQF 188
            :.|...      ||::|:..|      :||.    |..|.|..||  .|..|::.:.....  ..
 Worm   132 SQIKPY------STVSEMRGQLTKAVMDDYALNRYPEWPTFDFLKDVVTYGELWNESSSSA--NH 188

  Fly   189 VALVLQPKNSKI-GRDTLLELLPFKELSV--RIIEDSQIFNEFGLGPDDQKLAIVDRNGTAQYLT 250
            :|::.:...:.: |...||:|...::..|  |.::...:.....: .|...|||..|......|.
 Worm   189 IAIIFETNQASLTGAQLLLDLSGNRDRLVARRCLKSHPLAEALKI-TDFPSLAIFKRGERKPVLI 252

  Fly   251 PSSDSSEAYASTIGDFL---KNRNIQPDPPLPIAVAPNFTEFLDHQNQAI----LTKVLTPPLQV 308
              ::........|..||   .:.::|.            ..|...:|:.|    ..::..|...|
 Worm   253 --AELRRLLLREIDQFLGKPTDNHLQT------------IHFSSRKNKTIDCNKNPELCKPNYFV 303

  Fly   309 YRADLEQAIDKLLHIE-LRKWVLLEGNSLNALKNIIKIFRYLNPLN-----KDGKLLLTDLDNSL 367
            ...|:.:|:...|..| .|....|:..:|:||.....:.....|..     .|...:| .||.|.
 Worm   304 SEVDMLKAMRYALFRESARTGAPLQAANLSALYEFTSLLADTFPTTTIEGASDNSTVL-HLDRSS 367

  Fly   368 SSKQSIKGADFGDLVD-----------SLENGRRVFKA------------RRYVGCIGSRPLLRS 409
            .:.:.     |..|.|           |:|:.::.|.|            ..:..|.||....|.
 Worm   368 RAVRV-----FSRLRDFIAEKGLEAPISVEDWQKEFLAAEEEAGHPFPLNTNWEHCAGSSTQYRG 427

  Fly   410 FTCSMWTLFHHLTVEAAK-------------PPNYFEAGSILKTFHGFAKYFFGCTDCSEHFQQM 461
            :||.:||.||.|||.|.|             ||        |::...:...||||..|.:||.:|
 Worm   428 YTCGLWTTFHALTVSAFKNWQNKTNDITLPLPP--------LQSIRDWVGSFFGCNHCRDHFLKM 484

  Fly   462 A-----IRRNLTSVKTHDEEILWLWAAHNEVNARIAGDSTEDPKFPKIQFPSAENCPTCRS 517
            .     |..|   |:..::..|:||.|||:||||:.|..||||||||.|||:...|..|.:
 Worm   485 TTDTFKIEAN---VRRPEDVYLYLWKAHNKVNARLHGRETEDPKFPKYQFPAKFLCVDCNA 542

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Qsox2NP_650998.1 PDI_a_QSOX 40..152 CDD:239290 34/116 (29%)
Evr1_Alr 413..504 CDD:282612 42/109 (39%)
T10H10.2NP_508419.1 PDI_a_QSOX 34..149 CDD:239290 36/123 (29%)
Evr1_Alr 431..528 CDD:282612 41/108 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131143224
eggNOG 1 0.900 E1_KOG1731
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4773
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D158783at33208
OrthoFinder 1 1.000 FOG0001145
OrthoInspector 1 1.000 T98024
orthoMCL 1 0.900 OOG5_129038
Panther 1 1.100 O PTHR22897
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.660

Return to query results.
Submit another query.