DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Qsox2 and F35G2.1

Sequence 1:NP_650998.1 Gene:Qsox2 FlyBaseID:FBgn0038919 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_502314.1 Gene:F35G2.1 WormBaseID:WBGene00009435 Length:601 Species:Caenorhabditis elegans

Alignment Length:602 Identity:150/603 (25%)
Similarity:233/603 (39%) Gaps:101/603 (17%)


  Fly     7 TLLYCLLLIS--PAD---VLGRLNARKSANEASLYSDTDNVIM-LDIESLRPALNLKNSKLVQFL 65
            |.:.|||.|:  |..   |....|........:||:.....|| ||..:....:....:.||:|.
 Worm    12 TTISCLLFIAVLPVSIEAVQSTFNYVPIGQNPTLYTPGFEPIMHLDQMTFNDTVFSDRAFLVEFY 76

  Fly    66 NSFCGDCHRFAPVFKTLSRDLYKWRRILRIYAVDCAQERNAQLCREFNIRQTPSLRFFGPDMRKN 130
            ..:||.|..|||.|:..:..:..|..::.:..::||...|...|||..:...|.:::|.  ....
 Worm    77 ADWCGHCRAFAPYFRQFANMVRDWYPVVTVAVINCADSFNQAACRENGVTYFPMMKYFA--RTAT 139

  Fly   131 DDVLGAVIPGQDP---EFISSTLAELVSQNDY----GPGQPNFR-----------------PLKA 171
            ....|.:.  :.|   |.|...|...|| |:|    .|..||..                 |.||
 Worm   140 TATQGKLF--ETPHSAEQIRDALLRTVS-NEYMFNRYPDWPNLGHIAVDSRTTYGQLWDGVPQKA 201

  Fly   172 TDYEI-FQDQDGETPIQFVALVLQPKNSKIGRDTLLELLPFKE-LSVRIIEDSQIFNEFGLGPDD 234
            ....| |::.|| ...||| :.|..::..:|....|...|..: |::|......:|..     |.
 Worm   202 NYMAILFEEYDG-VGAQFV-MDLISRSHILGARRALSNSPLVQMLNIRNFPTVALFRR-----DH 259

  Fly   235 QKLAIVDR--NGTAQYLTPSSDSSEAYASTIGDFLKNRNIQPDPPLPIAVAPNF----------- 286
            |:...:.|  |.|.:      |..:|..:.:....:...|......|:....|.           
 Worm   260 QQALYMQRYTNQTVK------DIDDAITNDMEQGGRRAPILTTTLAPVTTTTNTPLIDCHSHPER 318

  Fly   287 ---------TEFLDHQNQAILTKVLTPPLQVYRADLEQAIDKLLHIELRKWVLLEGNSLNAL--K 340
                     |:.|.....|:|.:|...|..: |.|        ....|.:::.|..|....|  :
 Worm   319 CRDMYYVSETDMLKAMRMALLDEVTRVPGAI-RGD--------NFTNLHEFMTLLSNHFPVLSFQ 374

  Fly   341 NIIKIFRYLNPL------NKDGKLLLTDLDNSLSSKQSIKGADFGDLVDSLENGRRVFKA----- 394
            |.|:..|.....      ::..:|:.|.:...|..::||......:.....|:..||:.:     
 Worm   375 NDIRRMRAKRTTSVILRNSERARLVFTHMREFLEGRKSIGSVSSDEYRRQFESVERVYASPFPVN 439

  Fly   395 RRYVGCIGSRPLLRSFTCSMWTLFHHLTVEA---AKPPNYFEAGSILKTFHGFAKYFFGCTDCSE 456
            ..:..|.||.|:.|.:||.:||.||.|||..   ....:|......|.|..|:.|.:|||..|..
 Worm   440 STWQHCKGSSPMYRGYTCGLWTTFHALTVHTYIDTIKDDYVNPMKPLSTIQGWVKSYFGCEHCRN 504

  Fly   457 HFQQMA---IRRNLTSVKTHDEEILWLWAAHNEVNARIAGDSTEDPKFPKIQFPSAENCPTCRSN 518
            ||..|.   ...|...|:...:.:.:||.|||.||.|:.|||||||:|.|:|||:...||||.|.
 Worm   505 HFMHMTTTLFPLNERRVRHPHDMMTYLWRAHNIVNNRLHGDSTEDPQFTKMQFPAPFLCPTCHSG 569

  Fly   519 DSEWRTDEVLKYLKQLY 535
             .::...::..:|.:.|
 Worm   570 -GQFSRRQIRNFLLRYY 585

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Qsox2NP_650998.1 PDI_a_QSOX 40..152 CDD:239290 28/116 (24%)
Evr1_Alr 413..504 CDD:282612 38/97 (39%)
F35G2.1NP_502314.1 PDI_a_QSOX 51..162 CDD:239290 28/115 (24%)
Evr1_Alr 458..554 CDD:282612 37/96 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4773
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D158783at33208
OrthoFinder 1 1.000 FOG0001145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129038
Panther 1 1.100 O PTHR22897
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.