DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Qsox2 and QSOX2

Sequence 1:NP_650998.1 Gene:Qsox2 FlyBaseID:FBgn0038919 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_859052.3 Gene:QSOX2 HGNCID:30249 Length:698 Species:Homo sapiens

Alignment Length:563 Identity:169/564 (30%)
Similarity:273/564 (48%) Gaps:65/564 (12%)


  Fly    12 LLLISPADVLGRLNARKSANEASLY-SDTDNVIMLDIESLRPA-LNLKNSKLVQFLNSFCGDCHR 74
            ||::..|..:|    ..:...|.|| :..|.|.:||..|:|.| .|...:.||||.:|:||.|..
Human    36 LLVLLAAAAVG----PGAGGAARLYRAGEDAVWVLDSGSVRGATANSSAAWLVQFYSSWCGHCIG 96

  Fly    75 FAPVFKTLSRDLYKWRRILRIYAVDCAQERNAQLCREFNIRQTPSLRFFGPDMRKNDDVLGAVIP 139
            :||.::.|:.|:..|...:|:.|:||.:|:|..:|.:::|...|:.|:|....:  :...|....
Human    97 YAPTWRALAGDVRDWASAIRVAALDCMEEKNQAVCHDYDIHFYPTFRYFKAFTK--EFTTGENFK 159

  Fly   140 GQDPEF--ISSTLAELVSQNDYG---PGQPNFRPLKATDYEIFQDQDGETPIQFVALVLQPKNSK 199
            |.|.|.  :..|:.:.:..:..|   |..|...|::.:|.....|..|.   .:||:|.:..:|.
Human   160 GPDRELRTVRQTMIDFLQNHTEGSRPPACPRLDPIQPSDVLSLLDNRGS---HYVAIVFESNSSY 221

  Fly   200 IGRDTLLELLPFKELSV-RIIEDSQIFNEFGLGPDDQKLAIVD-----------RNGTAQYLTPS 252
            :||:.:|:|:|::.:.| |.::..:.|.|        ||.:..           .:|....:.|.
Human   222 LGREVILDLIPYESIVVTRALDGDKAFLE--------KLGVSSVPSCYLIYPNGSHGLINVVKPL 278

  Fly   253 SDSSEAYASTIGDFLKNRNIQPDPPLPIAVAPNFTEFLDHQNQAILTKVLTPPLQVYRADLEQAI 317
            .....:|..::.|..|.       .||:...|:     ..:|..|:........::|..|||..:
Human   279 RAFFSSYLKSLPDVRKK-------SLPLPEKPH-----KEENSEIVVWREFDKSKLYTVDLESGL 331

  Fly   318 DKLLHIELRKWVLLEGNSLNALKNIIKIFRYLNPLNKDGKLLLTDLDNSLSSKQSIKGADFGDLV 382
            ..||.:||.....|.|..|..||:.:.:...|.|.....|.||..|...|:| ..:....:..::
Human   332 HYLLRVELAAHKSLAGAELKTLKDFVTVLAKLFPGRPPVKKLLEMLQEWLAS-LPLDRIPYNAVL 395

  Fly   383 DSLENGRR---VFKAR--RYVGCIGSRPLLRSFTCSMWTLFHHLTVEAAKPPNYF-------EAG 435
            |.:.|..|   :|...  ::|||.|||..||.:.||:|.|||.|||||:..|:..       :..
Human   396 DLVNNKMRISGIFLTNHIKWVGCQGSRSELRGYPCSLWKLFHTLTVEASTHPDALVGTGFEDDPQ 460

  Fly   436 SILKTFHGFAKYFFGCTDCSEHFQQMAIRRNLTSVKTHDEEILWLWAAHNEVNARIAGDSTEDPK 500
            ::|:|...:...||||.:|.|||::|| :.::.||||.|:.|||||..||.||.|:||..:|||:
Human   461 AVLQTMRRYVHTFFGCKECGEHFEEMA-KESMDSVKTPDQAILWLWKKHNMVNGRLAGHLSEDPR 524

  Fly   501 FPKIQFPSAENCPTCRSND---SEWRTDEVLKYLKQLYDINNV 540
            |||:|:|:.:.||.|....   :.|....||.:|||.|..:|:
Human   525 FPKLQWPTPDLCPACHEEIKGLASWDEGHVLTFLKQHYGRDNL 567

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Qsox2NP_650998.1 PDI_a_QSOX 40..152 CDD:239290 37/115 (32%)
Evr1_Alr 413..504 CDD:282612 46/98 (47%)
QSOX2NP_859052.3 PDI_a_QSOX 61..174 CDD:239290 37/115 (32%)
Evr1_Alr 431..527 CDD:282612 45/97 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2482724
eggNOG 1 0.900 E1_KOG1731
Hieranoid 1 1.000
Homologene 1 1.000 H65608
Inparanoid 1 1.050 264 1.000 Inparanoid score I3024
Isobase 1 0.950 0 Normalized mean entropy S4773
OMA 1 1.010
OrthoDB 1 1.010 D158783at33208
OrthoFinder 1 1.000 FOG0001145
OrthoInspector 1 1.000 T130188
orthoMCL 1 0.900 OOG5_129038
Panther 1 1.100 O PTHR22897
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3816
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.