DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Qsox2 and Qsox1

Sequence 1:NP_650998.1 Gene:Qsox2 FlyBaseID:FBgn0038919 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001020116.1 Gene:Qsox1 MGIID:1330818 Length:748 Species:Mus musculus

Alignment Length:568 Identity:183/569 (32%)
Similarity:290/569 (51%) Gaps:69/569 (12%)


  Fly     7 TLLYCLLLISPADVL----GRLNARKSANEASLYSDTDNVIMLDIESLRP-ALNLKNSKLVQFLN 66
            :||..|||:||  :|    |...||.|.    |||.:|.:.:||.:|:|| .|...::..|:|..
Mouse    12 SLLLLLLLLSP--LLFSGPGAYAARLSV----LYSSSDPLTLLDADSVRPTVLGSSSAWAVEFFA 70

  Fly    67 SFCGDCHRFAPVFKTLSRDLYKWRRILRIYAVDCAQERNAQLCREFNIRQTPSLRFFGPDMRKND 131
            |:||.|..|||.:|.|:.|:..||..|.:..:|||:|.|:.:||||||...|::||| ....||.
Mouse    71 SWCGHCIAFAPTWKELANDVKDWRPALNLAVLDCAEETNSAVCREFNIAGFPTVRFF-QAFTKNG 134

  Fly   132 DVLGAVIP--GQDPEFISSTLAE-LVSQND-YGPGQPNFRPLKATDYEIFQDQDGETPIQFVALV 192
            .  ||.:|  |.:.:.:...|.: |.|..| :.|..|...|.|..|.:.|..::   ...::|||
Mouse   135 S--GATLPGAGANVQTLRMRLIDALESHRDTWPPACPPLEPAKLNDIDGFFTRN---KADYLALV 194

  Fly   193 LQPKNSKIGRDTLLELLPFKELSVRII--EDSQIFNEFGLGPDDQKLAIVDRNGTAQYLTPSSDS 255
            .:.::|.:||:..|:|..:..::||.:  .:|.:.|:||: .|.....::.|||:...:....:|
Mouse   195 FEREDSYLGREVTLDLSQYHAVAVRRVLNTESDLVNKFGV-TDFPSCYLLLRNGSVSRVPVLVES 258

  Fly   256 SEAYASTIGDFLK-----NRNIQPDPPLPIA---VAPNFTEFLDHQNQAILTKVLTPPLQVYRAD 312
            ...|.|    :|:     .|:..|....|:.   :||...:|.|..             ::|.||
Mouse   259 RSFYTS----YLRGLPGLTRDAPPTTATPVTADKIAPTVWKFADRS-------------KIYMAD 306

  Fly   313 LEQAIDKLLHIELRKWVLLEGNSLNALKNIIKIFRYLNPLNKDGKLLLTDLDNSLS------SKQ 371
            ||.|:..:|.:|:.|:.:|||..|.|||..:.:.....|    |:.|:.:..:|::      .|:
Mouse   307 LESALHYILRVEVGKFSVLEGQRLVALKKFVAVLAKYFP----GQPLVQNFLHSINDWLQKQQKK 367

  Fly   372 SIKGADFGDLVDSLENGRRVFKARRYVGCIGSRPLLRSFTCSMWTLFHHLTVEA-----AKPPNY 431
            .|..:.|...:||.:....:.:...:|||.||.|..|.|.||:|.|||.|||:|     |.|...
Mouse   368 RIPYSFFKAALDSRKEDAVLTEKVNWVGCQGSEPHFRGFPCSLWVLFHFLTVQANRYSEAHPQEP 432

  Fly   432 FEAGSILKTFHGFAKYFFGCTDCSEHFQQMAIRRNLTSVKTHDEEILWLWAAHNEVNARIAGDST 496
            .:...:|:....:.::||||.||::||:||| ..::..|::....|||||.:||.||||::|..:
Mouse   433 ADGQEVLQAMRSYVQFFFGCRDCADHFEQMA-AASMHQVRSPSNAILWLWTSHNRVNARLSGALS 496

  Fly   497 EDPKFPKIQFPSAENCPTCRSNDSE----WRTDEVLKYLKQLYDINNV 540
            |||.|||:|:|..|.|..|.:..:.    |.....|.:||..:...|:
Mouse   497 EDPHFPKVQWPPRELCSACHNELNGQVPLWDLGATLNFLKAHFSPANI 544

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Qsox2NP_650998.1 PDI_a_QSOX 40..152 CDD:239290 44/115 (38%)
Evr1_Alr 413..504 CDD:282612 42/96 (44%)
Qsox1NP_001020116.1 PDI_a_QSOX 43..155 CDD:239290 44/115 (38%)
Evr1_Alr 409..501 CDD:282612 39/93 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2385047
eggNOG 1 0.900 E1_KOG1731
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3001
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001145
OrthoInspector 1 1.000 T130964
orthoMCL 1 0.900 OOG5_129038
Panther 1 1.100 O PTHR22897
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3816
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.