DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Qsox2 and qsox2

Sequence 1:NP_650998.1 Gene:Qsox2 FlyBaseID:FBgn0038919 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001121505.1 Gene:qsox2 XenbaseID:XB-GENE-986398 Length:657 Species:Xenopus tropicalis

Alignment Length:584 Identity:156/585 (27%)
Similarity:269/585 (46%) Gaps:94/585 (16%)


  Fly     4 LLKTLLYCLLLISPADVLGRLNARKSANEASLYSDTDNVIMLDIESL-RPALNLKNSKLVQFLNS 67
            |.:::|..|:|..            |....:||...|.:.:|:.||: |...|..::.|::|.:|
 Frog     7 LFRSVLAVLVLFG------------SVGAEALYGPADPLSILNKESVTRAVFNSSSAWLLEFYSS 59

  Fly    68 FCGDCHRFAPVFKTLSRDLYKWRRILRIYAVDCAQERNAQLCREFNIRQTPSLRFF--------- 123
            :||.|..:||.::.|:||:..|...::|..:|||:|.|...|::|.:...|:.|||         
 Frog    60 WCGHCINYAPTWRALARDVSDWDPAIKIGVLDCAEEDNYGTCKDFGVTLYPTFRFFKAFTTEFTQ 124

  Fly   124 GPDMRKNDD-----VLGAVIPGQDPEFISSTLAELVSQNDYGPGQPNFRPLKATDYE--IFQDQD 181
            |.:.:..:|     |...:|     :|:.::.|:...|     ..|...|:.:::..  :.|.|.
 Frog   125 GENYKAGNDREIQTVRQVII-----DFLQTSPAQSKPQ-----ACPTLEPISSSEISSLLTQKQS 179

  Fly   182 GETPIQFVALVLQPKNSKIGRDTLLELLPFKELSVR--IIEDSQIFNEFGLGPDDQKLAIVDRNG 244
                 .:.|::.:.:.|.:||:.:|:|:.:..:.||  :..|..|..:.|:| ......::..||
 Frog   180 -----HYTAIIFESEESYVGREVMLDLIRYSNMVVRRALPSDKAILEKLGIG-SVPSCYLIQPNG 238

  Fly   245 TAQYLTPSSDSSEAYASTIGDFLKNRNIQPDPPLPIAVAPNFTEFL-----------DHQNQAIL 298
            :...:    ...:...:.:...||             ..||..:.|           |.|...:.
 Frog   239 SHGLI----KEVKCLRAQLSSHLK-------------ALPNVRKRLPSDTAHSGLNKDAQQGDVA 286

  Fly   299 TKVLTPPLQVYRADLEQAIDKLLHIELRKWVLLEGNSLNALKNIIKIFRYLNPLNKDGKLLLTDL 363
            .|..... ::|.||||..:..:|..||.....|||..|...|:.:.|...|.|.......||..|
 Frog   287 MKEFDRS-KLYMADLESGLHYVLRAELANHRTLEGEKLKTFKDFVTILYKLFPGRPHVMKLLETL 350

  Fly   364 DNSLSSKQSIKGADFGDLVDSLENGRRV-----FKARRYVGCIGSRPLLRSFTCSMWTLFHHLTV 423
            ...|.| ..:....:..::|.:.|..|:     ....::|||.||:..||.:.||:|.|||.|||
 Frog   351 QEWLVS-MPLDKIPYDAILDLVNNRMRISGIFLTNHTQWVGCRGSKSHLRGYPCSLWKLFHSLTV 414

  Fly   424 EAAKPPNYF-------EAGSILKTFHGFAKYFFGCTDCSEHFQQMAIRRNLTSVKTHDEEILWLW 481
            :|:..|:..       :..::|:|...:.:.||||.:|::||:.|| :..:.||:|.|:.:||||
 Frog   415 QASVKPDALANTALGADPQAVLQTMRSYIREFFGCRECAKHFEAMA-KETMDSVRTPDQAVLWLW 478

  Fly   482 AAHNEVNARIAGDSTEDPKFPKIQFPSAENCPTCR----SNDSEWRTDEVLKYLKQLYDINNVS 541
            ..||.||.|::|..:|||||||:|:|:::.|..|.    .....|..:|||.:||:.|....:|
 Frog   479 RKHNAVNNRLSGAPSEDPKFPKVQWPTSDLCSACHGQTGGGTQSWNENEVLSFLKRYYGKQEIS 542

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Qsox2NP_650998.1 PDI_a_QSOX 40..152 CDD:239290 36/127 (28%)
Evr1_Alr 413..504 CDD:282612 42/98 (43%)
qsox2NP_001121505.1 PDI_a_QSOX 31..145 CDD:239290 34/119 (29%)
Evr1_Alr 404..501 CDD:282612 42/98 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2475849
eggNOG 1 0.900 E1_KOG1731
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H65608
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D158783at33208
OrthoFinder 1 1.000 FOG0001145
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.