DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Qsox2 and qsox1

Sequence 1:NP_650998.1 Gene:Qsox2 FlyBaseID:FBgn0038919 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001121836.1 Gene:qsox1 ZFINID:ZDB-GENE-030131-7019 Length:778 Species:Danio rerio

Alignment Length:554 Identity:168/555 (30%)
Similarity:278/555 (50%) Gaps:90/555 (16%)


  Fly    32 EASLYSDTDNVIMLDIESLRPAL-NLKNSKLVQFLNSFCGDCHRFAPVFKTLSRDLYKWRRILRI 95
            ||.||:.:|.||:|..|::...| |...:.||:|..::||.|..|:||:|:|:||:.:|:..:.:
Zfish    40 EAGLYTASDQVIVLTPENVDSTLFNNTAALLVEFYATWCGHCIAFSPVWKSLARDIKEWKPAVDL 104

  Fly    96 YAVDCAQERNAQLCREFNIRQTPSLRFF---------GPDMRK-NDDVLGAVIPGQDPEFISSTL 150
            .|:|||.|.|.::|..|.|...||::||         |.::|. :.||.|.      .::|...|
Zfish   105 AAIDCANESNRKVCTNFGITGYPSIKFFHAYSSIGSRGLEVRGFSRDVRGL------RQYIIENL 163

  Fly   151 AELVSQNDYGPGQPNFRPLK-ATDYEIFQDQDGETPIQFVALVLQPKNSKIGRDTLLELLPFKEL 214
             ||.:: .:.|..|   ||: |::.|:........ ::::|||.:.|.|.:||:..|:||.::.:
Zfish   164 -ELHTE-AWPPACP---PLETASEAEVHHFFPANN-VKYLALVFENKKSYVGREVTLDLLQYENI 222

  Fly   215 SVRIIEDSQ--IFNEFGLGPDDQKLAIVDRNGTAQYLTPSSDSSEAYA----------------S 261
            :||.:.|::  :.:.||: .:.....:.|.:|....|....::...|:                :
Zfish   223 AVRRVLDTETNLVSRFGV-TEFPSCYLYDSSGNITRLKVLKEARTFYSYALQRLPGVVRTGKHQT 286

  Fly   262 TIGDFLKNRNIQPDPPLPIAVAPNFTEFLDHQNQAILTKVLTPPLQVYRADLEQAIDKLLHIELR 326
            .|.:.:||..:|...|.               |::          :||.:|||.|:...|.:||.
Zfish   287 PITELIKNSTLQEWRPF---------------NKS----------RVYMSDLESALHYSLRVELS 326

  Fly   327 KWVLLEGNSLNALKNIIKIFRYLNPLNKDGKLLLTDLDNSLSSKQ--SIKGADFGDLVDS-LENG 388
            ....:.|:.|.|||..|.:.....|.....|..|..:|:.|.|::  .||.:||.|::|: ::..
Zfish   327 SHTSISGDDLIALKKYINVLAKYFPGRPSVKSALQAVDSWLQSQKGTEIKYSDFRDVLDNVVQTS 391

  Fly   389 RRVF-KARRYVGCIGSRPLLRSFTCSMWTLFHHLTVEAAKPPNYFEAGS-------ILKTFHGFA 445
            ..|. :..::|||.||:...|.:.|::|||||.|||:|.      |.||       :|....|:.
Zfish   392 DAVLPEGVQWVGCQGSQARYRGYPCAVWTLFHVLTVQAK------EMGSTVSEPQEVLLAMRGYV 450

  Fly   446 KYFFGCTDCSEHFQQMAIRRNLTSVKTHDEEILWLWAAHNEVNARIAGDSTEDPKFPKIQFPSAE 510
            ..||||..|:.||:.|| ..::..|.:....::|||:.||.||.|:|||.:|||.|||||:||.|
Zfish   451 SSFFGCRPCATHFEAMA-AESMDQVNSLSGAVIWLWSRHNRVNNRLAGDLSEDPHFPKIQWPSPE 514

  Fly   511 NCPTCRS----NDSEWRTDEVLKYLKQLYDINNV 540
            .||:|..    .|..|..|||.::|:..:..:.:
Zfish   515 LCPSCHGVTIIGDHNWIKDEVPQFLQNYFSSSRI 548

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Qsox2NP_650998.1 PDI_a_QSOX 40..152 CDD:239290 41/123 (33%)
Evr1_Alr 413..504 CDD:282612 41/98 (42%)
qsox1NP_001121836.1 PDI_a_QSOX 48..161 CDD:239290 40/119 (34%)
Evr1_Alr 417..508 CDD:282612 41/98 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2330961
eggNOG 1 0.900 E1_KOG1731
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 272 1.000 Inparanoid score I2901
OMA 1 1.010
OrthoDB 1 1.010 D158783at33208
OrthoFinder 1 1.000 FOG0001145
OrthoInspector 1 1.000 T128705
orthoMCL 1 0.900 OOG5_129038
Panther 1 1.100 O PTHR22897
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.770

Return to query results.
Submit another query.