DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cby and Cby1

DIOPT Version :8

Sequence 1:NP_650989.6 Gene:Cby / 42574 FlyBaseID:FBgn0067317 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_006521547.1 Gene:Cby1 / 73739 MGIID:1920989 Length:139 Species:Mus musculus

Alignment Length:86 Identity:33/87 (38%)
Similarity:53/87 (61%) Gaps:6/87 (7%)


  Fly    52 ATEDLD---DFRQISLTLGNKELRFADGIWM-HSTRKGDVD--DMLRLNKKFRALEEENNMCNLK 110
            :|.:|:   |:...::.|..:.|:|.:|.|: .|...|.||  :..||.|:.:.||||||:..||
Mouse    42 STRELELGLDYGTPTMNLAGQSLKFENGQWVADSVISGGVDRRETQRLRKRNQQLEEENNLLRLK 106

  Fly   111 IEVMLDLLAEATELSELKPKE 131
            ::::||:|:|.|..|.||.||
Mouse   107 VDILLDMLSETTAESHLKDKE 127

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CbyNP_650989.6 None
Cby1XP_006521547.1 Chibby 23..126 CDD:291318 31/84 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2DQN5
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007488
OrthoInspector 1 1.000 T1082420
orthoMCL 1 0.900 OOG5_135061
Panther 1 1.100 LDO PTHR21533
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4979
TreeFam 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.