DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cby and AgaP_AGAP004219

DIOPT Version :9

Sequence 1:NP_650989.6 Gene:Cby / 42574 FlyBaseID:FBgn0067317 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_001688425.2 Gene:AgaP_AGAP004219 / 5667550 VectorBaseID:AGAP004219 Length:118 Species:Anopheles gambiae


Alignment Length:116 Identity:52/116 - (44%)
Similarity:73/116 - (62%) Gaps:13/116 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MPLFNKKFESKPIPVRQGRCNIGHPVATEDLDDFRQISLTLGNKELRFADGIWMHSTRKGD---- 86
            ||:|.|||..|..|.|..|.|||.|...|||||||.|:|.|.:|:|.|.||:|::..:.|.    
Mosquito     1 MPIFQKKFAPKVAPPRTQRLNIGCPPPAEDLDDFRTITLNLVDKQLCFIDGVWLNGLKPGPGGSV 65

  Fly    87 --------VDDMLRLNKKFRALEEENNMCNLKIEVMLDLLAE-ATELSELK 128
                    .||:||:.::.:|||:||||..:|::|::|||.| ..||:|:|
Mosquito    66 ASGSGVNVTDDLLRMKRRMKALEQENNMLQVKLDVLVDLLTENVIELNEIK 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CbyNP_650989.6 None
AgaP_AGAP004219XP_001688425.2 Chibby 1..117 CDD:291318 52/116 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 97 1.000 Domainoid score I13517
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H122735
Inparanoid 1 1.050 102 1.000 Inparanoid score I7299
OMA 1 1.010 - - QHG27014
OrthoDB 1 1.010 - - D1492677at2759
OrthoFinder 1 1.000 - - FOG0007162
OrthoInspector 1 1.000 - - otm50803
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X13600
TreeFam 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.