DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cby and RGD1306441

DIOPT Version :9

Sequence 1:NP_650989.6 Gene:Cby / 42574 FlyBaseID:FBgn0067317 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001099523.1 Gene:RGD1306441 / 290425 RGDID:1306441 Length:274 Species:Rattus norvegicus


Alignment Length:44 Identity:14/44 - (31%)
Similarity:20/44 - (45%) Gaps:8/44 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NKELRFADGIWMHSTRKGDVDDMLRLNKKFRALEEENNMCNLKI 111
            ||.||...|...        |:.:.|.::.|.|:|.||:...||
  Rat   219 NKALREEHGALQ--------DEEVALQEEARILQEWNNLLQGKI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CbyNP_650989.6 None
RGD1306441NP_001099523.1 SMC_prok_A <83..>245 CDD:274009 9/33 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21533
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.