powered by:
Protein Alignment Cby and RGD1306441
DIOPT Version :9
Sequence 1: | NP_650989.6 |
Gene: | Cby / 42574 |
FlyBaseID: | FBgn0067317 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001099523.1 |
Gene: | RGD1306441 / 290425 |
RGDID: | 1306441 |
Length: | 274 |
Species: | Rattus norvegicus |
Alignment Length: | 44 |
Identity: | 14/44 - (31%) |
Similarity: | 20/44 - (45%) |
Gaps: | 8/44 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 NKELRFADGIWMHSTRKGDVDDMLRLNKKFRALEEENNMCNLKI 111
||.||...|... |:.:.|.::.|.|:|.||:...||
Rat 219 NKALREEHGALQ--------DEEVALQEEARILQEWNNLLQGKI 254
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Cby | NP_650989.6 |
None |
RGD1306441 | NP_001099523.1 |
SMC_prok_A |
<83..>245 |
CDD:274009 |
9/33 (27%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR21533 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.