DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cby and CBY1

DIOPT Version :8

Sequence 1:NP_650989.6 Gene:Cby / 42574 FlyBaseID:FBgn0067317 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001002880.2 Gene:CBY1 / 25776 HGNCID:1307 Length:169 Species:Homo sapiens

Alignment Length:116 Identity:38/117 (32%)
Similarity:66/117 (56%) Gaps:11/117 (9%)


  Fly    26 MPLFNKKFESKPIPVRQGR--CNIGHPV--ATEDLD---DFRQISLTLGNKELRFADGIWMHSTR 83
            ||.|...|..|..|.|:..  .|: |.:  :|.:::   ::...::.|..:.|:|.:|.|:..|.
Human    44 MPFFGNTFSPKKTPPRKSASLSNL-HSLDRSTREVELGLEYGSPTMNLAGQSLKFENGQWIAETG 107

  Fly    84 -KGDVD--DMLRLNKKFRALEEENNMCNLKIEVMLDLLAEATELSELKPKE 131
             .|.||  ::.||.::.:.||||||:..||::::||:|:|:|..|.|..||
Human   108 VSGGVDRREVQRLRRRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKE 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CbyNP_650989.6 None
CBY1NP_001002880.2 Chibby 44..157 CDD:317091 36/114 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2DQN5
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492677at2759
OrthoFinder 1 1.000 FOG0007488
OrthoInspector 1 1.000 T1072357
orthoMCL 1 0.900 OOG5_135061
Panther 1 1.100 LDO PTHR21533
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.