DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cby and CBY1

DIOPT Version :10

Sequence 1:NP_650989.7 Gene:Cby / 42574 FlyBaseID:FBgn0067317 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_056188.1 Gene:CBY1 / 25776 HGNCID:1307 Length:126 Species:Homo sapiens


Alignment Length:117 Identity:38/117 - (32%)
Similarity:65/117 - (55%) Gaps:12/117 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MPLFNKKFESKPIPVRQGR--CNIGHPV--ATEDLD---DFRQISLTLGNKELRFADGIWMHSTR 83
            ||.|...|..|..|.|:..  .|: |.:  :|.:::   ::...::.|..:.|:|.:|.|:..|.
Human     1 MPFFGNTFSPKKTPPRKSASLSNL-HSLDRSTREVELGLEYGSPTMNLAGQSLKFENGQWIAETG 64

  Fly    84 -KGDVD--DMLRLNKKFRALEEENNMCNLKIEVMLDLLAEHATELSELKPKE 132
             .|.||  ::.||.::.:.||||||:..||::::||:|:|...| |.|..||
Human    65 VSGGVDRREVQRLRRRNQQLEEENNLLRLKVDILLDMLSESTAE-SHLMEKE 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CbyNP_650989.7 Cby_like 26..124 CDD:143631 33/107 (31%)
CBY1NP_056188.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 8/25 (32%)
Chibby 2..115 CDD:464233 35/114 (31%)
Minimal region for the interaction with PKD2. /evidence=ECO:0000269|PubMed:15194699 60..112 20/52 (38%)
Leucine-zipper, mediates homodimerization. /evidence=ECO:0000269|PubMed:19435523 77..98 9/20 (45%)

Return to query results.
Submit another query.