DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cby and mug135

DIOPT Version :8

Sequence 1:NP_650989.6 Gene:Cby / 42574 FlyBaseID:FBgn0067317 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_587704.1 Gene:mug135 / 2538967 PomBaseID:SPCC330.04c Length:357 Species:Schizosaccharomyces pombe

Alignment Length:42 Identity:11/43 (26%)
Similarity:17/43 (40%) Gaps:4/43 (9%)


  Fly    24 FAMPLFNKKFESKPIPVRQGRCNIGHPVATEDLDDFRQISLT 65
            ||.|:....|.:..||    ..|:......||:|...:.:.|
pombe   275 FAQPITEVPFFNGDIP----DPNLPRITRIEDIDSLSEENCT 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CbyNP_650989.6 None
mug135NP_587704.1 DUF1773 261..317 CDD:285759 11/43 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21533
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.