DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cby and Cby1

DIOPT Version :9

Sequence 1:NP_650989.6 Gene:Cby / 42574 FlyBaseID:FBgn0067317 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_663709.1 Gene:Cby1 / 246768 RGDID:708481 Length:127 Species:Rattus norvegicus


Alignment Length:116 Identity:43/116 - (37%)
Similarity:66/116 - (56%) Gaps:11/116 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MPLFNKKFESKPIPVRQGR--CNIGHPV--ATEDLD---DFRQISLTLGNKELRFADGIWM-HST 82
            ||||...|..|..|.|:..  .|: |.:  :|.:|:   |:...::.|..:.|:|.:|.|: .|.
  Rat     1 MPLFGSIFSPKKTPPRKSASLSNL-HSLDRSTRELELGLDYGTPTMNLAGQSLKFENGQWVADSV 64

  Fly    83 RKGDVD--DMLRLNKKFRALEEENNMCNLKIEVMLDLLAEATELSELKPKE 131
            ..|.||  :..||.|:.:.||||||:..||::::||:|:|.|..|.||.||
  Rat    65 ISGGVDRRETQRLRKRNQQLEEENNLLRLKVDILLDMLSETTAESHLKDKE 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CbyNP_650989.6 None
Cby1NP_663709.1 Chibby 1..114 CDD:405348 41/113 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 9/24 (38%)
Minimal region for the interaction with PKD2. /evidence=ECO:0000250 60..112 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492677at2759
OrthoFinder 1 1.000 - - FOG0007162
OrthoInspector 1 1.000 - - oto97784
orthoMCL 1 0.900 - - OOG6_108796
Panther 1 1.100 - - LDO PTHR21533
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.