DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cby and Cby1

DIOPT Version :8

Sequence 1:NP_650989.6 Gene:Cby / 42574 FlyBaseID:FBgn0067317 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_663709.1 Gene:Cby1 / 246768 RGDID:708481 Length:127 Species:Rattus norvegicus

Alignment Length:116 Identity:43/117 (37%)
Similarity:66/117 (56%) Gaps:11/117 (9%)


  Fly    26 MPLFNKKFESKPIPVRQGR--CNIGHPV--ATEDLD---DFRQISLTLGNKELRFADGIWM-HST 82
            ||||...|..|..|.|:..  .|: |.:  :|.:|:   |:...::.|..:.|:|.:|.|: .|.
  Rat     1 MPLFGSIFSPKKTPPRKSASLSNL-HSLDRSTRELELGLDYGTPTMNLAGQSLKFENGQWVADSV 64

  Fly    83 RKGDVD--DMLRLNKKFRALEEENNMCNLKIEVMLDLLAEATELSELKPKE 131
            ..|.||  :..||.|:.:.||||||:..||::::||:|:|.|..|.||.||
  Rat    65 ISGGVDRRETQRLRKRNQQLEEENNLLRLKVDILLDMLSETTAESHLKDKE 115

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CbyNP_650989.6 None
Cby1NP_663709.1 Chibby 1..114 CDD:317091 41/114 (36%)
Minimal region for the interaction with PKD2. {ECO:0000250} 60..112 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2DQN5
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1492677at2759
OrthoFinder 1 1.000 FOG0007488
OrthoInspector 1 1.000 T1086017
orthoMCL 1 0.900 OOG5_135061
Panther 1 1.100 LDO PTHR21533
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.