DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cby and CBY2

DIOPT Version :9

Sequence 1:NP_650989.6 Gene:Cby / 42574 FlyBaseID:FBgn0067317 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_011533273.1 Gene:CBY2 / 220082 HGNCID:30720 Length:475 Species:Homo sapiens


Alignment Length:115 Identity:26/115 - (22%)
Similarity:44/115 - (38%) Gaps:36/115 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PLFNKKFESKPI-PVRQGRCNIGHPVATEDLD-DFRQISLTLGNKELRFADGIW----------- 78
            ||  .:|.|.|: |:.:       |::..||: |:....:.|.::...|.||.|           
Human   118 PL--NRFSSVPLDPMER-------PMSQADLELDYNPPRVQLSDEMFVFQDGRWVNENCRLQSPY 173

  Fly    79 ----------MHSTRKGDVDDMLRLNKKFR----ALEEENNMCNLKIEVM 114
                      :|..|......:...||..|    ||.|||.|.:.:.:::
Human   174 FSPSASFHHKLHHKRLAKECMLQEENKSLREENKALREENRMLSKENKIL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CbyNP_650989.6 None
CBY2XP_011533273.1 Cby_like 104..219 CDD:143631 26/109 (24%)
Cby_like 332..454 CDD:299860
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21533
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.