DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lsn and vps-22

DIOPT Version :8

Sequence 1:NP_650987.1 Gene:lsn / 42572 FlyBaseID:FBgn0260940 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_498052.1 Gene:vps-22 / 175672 WormBaseID:WBGene00016167 Length:269 Species:Caenorhabditis elegans

Alignment Length:254 Identity:116/255 (45%)
Similarity:173/255 (68%) Gaps:4/255 (2%)


  Fly     2 RRRVGLGAIQQQKLAAEKYKDKGTDLQENQLEQMTKQMEVFRVKLEEFAMKHKEDIRKNSQFRKQ 66
            |||:|:.|||:::..|.|:..||..:...||.|.::|:|.....||.||.:|:::|:||||||:.
 Worm     4 RRRIGVAAIQKKQETANKFAAKGDQMAGEQLVQFSQQLEQLSAGLEMFAQRHRDEIKKNSQFRRH 68

  Fly    67 FQEMCAAIGVDPLATGKGFWS-VLGMGDFYYELGVQVVEVCLAANHKTGGLMELDDLRRRLIAAR 130
            ||||||::||||||:.||||: .||.||||||||:|:||:||:..|..||:|.::::|.||:..|
 Worm    69 FQEMCASVGVDPLASSKGFWAKALGFGDFYYELGIQIVEICLSTTHINGGIMTVEEIRNRLMRTR 133

  Fly   131 GQSSVHQEITKEDILMAAKKLSIFGNGFVVHKLGKGKYIVQSIPGELSMEETNILNAASNTEQGC 195
            .::. ...|:.:|||.|..||.:.||||.:..||.|:::|||:||||||:.:.:|..|.  :...
 Worm   134 SRTR-KDTISTDDILRAVDKLKVLGNGFELVPLGGGRFLVQSVPGELSMDHSRVLQLAE--DAAY 195

  Fly   196 VTQSQLIKDLGWTDYRAQQSLDKVLGEGLCWIDKQAGDEPAYWFPSLFPGRNAQTTAAT 254
            ||:..:|..|.|.:.||..:|:.::.|||.|.|:||.|...|||||||..:...::::|
 Worm   196 VTKELIIDKLRWDEARASSALEHLVKEGLAWTDEQASDTTQYWFPSLFLQQYCHSSSST 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lsnNP_650987.1 EAP30 6..228 CDD:282067 101/223 (45%)
vps-22NP_498052.1 EAP30 8..228 CDD:282067 101/223 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C152828094
eggNOG 1 0.900 E1_KOG3341
Hieranoid 1 1.000
Homologene 1 1.000 H5239
Inparanoid 1 1.050 242 1.000 Inparanoid score I2068
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D554010at33208
OrthoFinder 1 1.000 FOG0003460
OrthoInspector 1 1.000 T476645
orthoMCL 1 0.900 OOG5_128498
Panther 1 1.100 LDO PTHR12806
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3694
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.