DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpI12 and RPA12

DIOPT Version :9

Sequence 1:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_012597.1 Gene:RPA12 / 853526 SGDID:S000003824 Length:125 Species:Saccharomyces cerevisiae


Alignment Length:117 Identity:43/117 - (36%)
Similarity:61/117 - (52%) Gaps:6/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FCPSCGSIL--PELQVKGNVICYNCKKEFQPDVYSGEKSEFTIHFNTYDPS----KVFNRTKRES 68
            ||..||.:|  |...:..||.|..||..:....:|..|...|...:.:..|    |...:|..:.
Yeast     9 FCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSSLRAKKSVVKTSLKK 73

  Fly    69 ESDADGPVVERKCPKCNHDKMSYATLQLRSADEGQTVFFTCLKCKFKESENS 120
            ....||..::.|||:|.:::|:|.||||||||||.|||:||..|.:|...|:
Yeast    74 NELKDGATIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRTNN 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpI12NP_524439.1 RPB9 10..119 CDD:224510 42/114 (37%)
Zn-ribbon_RPA12 73..119 CDD:259792 25/45 (56%)
RPA12NP_012597.1 RPB9 6..124 CDD:224510 42/114 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346599
Domainoid 1 1.000 58 1.000 Domainoid score I2634
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1622
Isobase 1 0.950 - 0 Normalized mean entropy S1392
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003996
OrthoInspector 1 1.000 - - oto99980
orthoMCL 1 0.900 - - OOG6_103317
Panther 1 1.100 - - LDO PTHR11239
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1171
SonicParanoid 1 1.000 - - X2760
TreeFam 1 0.960 - -
1413.730

Return to query results.
Submit another query.