DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1H and RPA12

DIOPT Version :10

Sequence 1:NP_524439.1 Gene:Polr1H / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_012597.1 Gene:RPA12 / 853526 SGDID:S000003824 Length:125 Species:Saccharomyces cerevisiae


Alignment Length:117 Identity:43/117 - (36%)
Similarity:61/117 - (52%) Gaps:6/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FCPSCGSIL--PELQVKGNVICYNCKKEFQPDVYSGEKSEFTIHFNTYDPS----KVFNRTKRES 68
            ||..||.:|  |...:..||.|..||..:....:|..|...|...:.:..|    |...:|..:.
Yeast     9 FCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSSLRAKKSVVKTSLKK 73

  Fly    69 ESDADGPVVERKCPKCNHDKMSYATLQLRSADEGQTVFFTCLKCKFKESENS 120
            ....||..::.|||:|.:::|:|.||||||||||.|||:||..|.:|...|:
Yeast    74 NELKDGATIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRTNN 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr1HNP_524439.1 RPB9 10..115 CDD:441202 41/110 (37%)
Zn-ribbon_RPA12 73..119 CDD:259792 25/45 (56%)
RPA12NP_012597.1 RPB9 9..122 CDD:441202 42/112 (38%)
Zn-ribbon_RPA12 78..124 CDD:259792 25/45 (56%)

Return to query results.
Submit another query.