DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpI12 and RPC11

DIOPT Version :8

Sequence 1:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_010330.1 Gene:RPC11 / 851615 SGDID:S000002452 Length:110 Species:Saccharomyces cerevisiae

Alignment Length:124 Identity:34/125 (27%)
Similarity:50/125 (40%) Gaps:31/125 (25%)


  Fly    10 FCPSCGSILPELQVKGN-----VICYNCKKEFQPDVYSGEKSEFTIHFNTYDPSKVFNRTKRESE 69
            |||||.::|  |...|:     :.|.:|..||..:           ....||..|:    .|:..
Yeast     4 FCPSCNNML--LITSGDSGVYTLACRSCPYEFPIE-----------GIEIYDRKKL----PRKEV 51

  Fly    70 SDADG------PVVERKCPK---CNHDKMSYATLQLRSADEGQTVFFTCLKCKFKESEN 119
            .|..|      ...:.:||.   |..:...:..||:|||||..|.|:.|:.|..:..||
Yeast    52 DDVLGGGWDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKEN 110

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI12NP_524439.1 RPB9 10..119 CDD:224510 33/123 (27%)
Zn-ribbon_RPA12 73..119 CDD:259792 16/55 (29%)
RPC11NP_010330.1 RPB9 1..110 CDD:224510 33/123 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.