DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpI12 and Tcea3

DIOPT Version :8

Sequence 1:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_006538773.1 Gene:Tcea3 / 21401 MGIID:1196908 Length:385 Species:Mus musculus

Alignment Length:33 Identity:14/34 (41%)
Similarity:18/34 (53%) Gaps:0/34 (0%)


  Fly    80 KCPKCNHDKMSYATLQLRSADEGQTVFFTCLKC 112
            :|.||.....:|..:|.|||||..|.|..|.:|
Mouse   346 RCSKCKKKNCTYNQVQTRSADEPMTTFVLCNEC 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI12NP_524439.1 RPB9 10..119 CDD:224510 14/34 (41%)
Zn-ribbon_RPA12 73..119 CDD:259792 14/34 (41%)
Tcea3XP_006538773.1 TFIIS_I 4..93 CDD:238107
TFSII 5..385 CDD:273592 14/34 (41%)
TFS2M 222..323 CDD:128786
Zn-ribbon_TFIIS 338..384 CDD:259796 14/34 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.