DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and SSN3

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_015283.1 Gene:SSN3 SGDID:S000005963 Length:555 Species:Saccharomyces cerevisiae

Alignment Length:388 Identity:97/389 (25%)
Similarity:163/389 (42%) Gaps:117/389 (30%)


  Fly     8 RYKMLEKIGEGVHGCVFKA------------------------------------IDLQRN---- 32
            :|:::..|..|.:|.|:||                                    :|:|.|    
Yeast    74 KYEVIGYIAAGTYGKVYKAKRQINSGTNSANGSSLNGTNAKIPQFDSTQPKSSSSMDMQANTNAL 138

  Fly    33 -----------------------------KEVAIKK-----VALKN-----------KFGNIALN 52
                                         |:..|||     .|:|.           .:..|:.:
Yeast   139 RRNLLKDEGVTPGRIRTTREDVSPHYNSQKQTLIKKPLTVFYAIKKFKTEKDGVEQLHYTGISQS 203

  Fly    53 TLREIKTLQLCKSEYILDIIDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSR----QQVRKFAH 113
            ..||:...:...::::..:::|:.:...:.:|.||....|...:....:|..|    :.||....
Yeast   204 ACREMALCRELHNKHLTTLVEIFLERKCVHMVYEYAEHDLLQIIHFHSHPEKRMIPPRMVRSIMW 268

  Fly   114 QMFKGIAYLHEAGLMHRDIKPANLLISDTDMLKIADFGLARLYFPEDESRLYSPQ--VSTRWYRA 176
            |:..|::|||:..::|||:||||::::....:||.|.|||| .|......||:..  |.|.||||
Yeast   269 QLLDGVSYLHQNWVLHRDLKPANIMVTIDGCVKIGDLGLAR-KFHNMLQTLYTGDKVVVTIWYRA 332

  Fly   177 PEILFGSQKYGTGVDMWAAGCVVAEMLRGVPLFAGTT-----------DIEQLAIIIRTLGSPRL 230
            ||:|.|::.|...||:|:.||:.||::...|:|.|..           .:.||..|:..||:|..
Yeast   333 PELLLGARHYTPAVDLWSVGCIFAELIGLQPIFKGEEAKLDSKKTVPFQVNQLQRILEVLGTPDQ 397

  Fly   231 NQWPELTSLPDYSKI-RFPNSVGIHWDNL---FPSC----THAVEINLVSNLVVYNPKNRLKA 285
            ..||.|...|:|.:| :||.    :.|||   :.|.    .||  ::|:.:|:.|:|..|:.|
Yeast   398 KIWPYLEKYPEYDQITKFPK----YRDNLATWYHSAGGRDKHA--LSLLYHLLNYDPIKRIDA 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 97/389 (25%)
S_TKc 9..288 CDD:214567 97/388 (25%)
SSN3NP_015283.1 STKc_CDK8_like 74..463 CDD:270834 97/389 (25%)
S_TKc 180..463 CDD:214567 83/283 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110027126
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.