DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and RIM11

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_013859.1 Gene:RIM11 SGDID:S000004747 Length:370 Species:Saccharomyces cerevisiae

Alignment Length:289 Identity:101/290 (35%)
Similarity:164/290 (57%) Gaps:34/290 (12%)


  Fly    13 EKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDI------ 71
            |.:|.|..|.||..:..:.|::||||||....:|.|      ||::.:::.....|:|:      
Yeast    43 EVVGHGSFGVVFATVIQETNEKVAIKKVLQDKRFKN------RELEIMKMLSHINIIDLKYFFYE 101

  Fly    72 ----IDIYPDLTGLSLVLEYQPDTLYNRLKSEVN---PLSRQQVRKFAHQMFKGIAYLHE-AGLM 128
                .:||     |:|:|||.|.:||.||:..|:   |:||.:::.:..|:||.:.|||. |.:.
Yeast   102 RDSQDEIY-----LNLILEYMPQSLYQRLRHFVHQRTPMSRLEIKYYMFQLFKSLNYLHHFANVC 161

  Fly   129 HRDIKPANLLIS-DTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDM 192
            ||||||.|||:. :|..||:.|||.|:...|.:.:..|   :.:|:|||||::||:..|...:|:
Yeast   162 HRDIKPQNLLVDPETWSLKLCDFGSAKQLKPTEPNVSY---ICSRYYRAPELIFGATNYTNQIDI 223

  Fly   193 WAAGCVVAEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSL-PDYSKIRFPNSVGIHWD 256
            |::|||:||:|.|.|:|.|.:.|:||..||:.||:|...   |:.|: |:|.:.:||....|...
Yeast   224 WSSGCVMAELLLGQPMFPGESGIDQLVEIIKILGTPSKQ---EICSMNPNYMEHKFPQIKPIPLS 285

  Fly   257 NLFPSCTHAVEINLVSNLVVYNPKNRLKA 285
            .:|.. .....:..:::::.|:|..|..|
Yeast   286 RVFKK-EDDQTVEFLADVLKYDPLERFNA 313

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 101/290 (35%)
S_TKc 9..288 CDD:214567 101/290 (35%)
RIM11NP_013859.1 STKc_GSK3 34..325 CDD:271039 101/290 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.