DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and CAK1

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_116624.1 Gene:CAK1 SGDID:S000001865 Length:368 Species:Saccharomyces cerevisiae

Alignment Length:271 Identity:67/272 (25%)
Similarity:117/272 (43%) Gaps:77/272 (28%)


  Fly    26 AIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDIIDI-YPDLTGLSLVLEYQP 89
            |:|.......|..:|::.||.||               |.::||.:::. ..|...|.|:..::.
Yeast    34 ALDFDIPPHNAKFEVSILNKLGN---------------KCKHILPLLESKATDNNDLLLLFPFEE 83

  Fly    90 DTL-------YNRLKSEVNP-----------LSRQQVRK-------------FAHQMFKGIAYLH 123
            ..|       |.|.:.:.||           ::...|:|             |..||.:|||:||
Yeast    84 MNLYEFMQMHYKRDRRKKNPYYDLLNPSIPIVADPPVQKYTNQLDVNRYSLSFFRQMVEGIAFLH 148

  Fly   124 EAGLMHRDIKPANLLISD-----TDMLKIADFGLARLYFPEDESRLYS-------PQVSTRWYRA 176
            |..::||||||.|:::::     :..|.|.|||::  |...:.|:..:       ..:||..|:|
Yeast   149 ENKIIHRDIKPQNIMLTNNTSTVSPKLYIIDFGIS--YDMANNSQTSAEPMDSKVTDISTGIYKA 211

  Fly   177 PEILFGSQKYGTGVDMWAAGCVVAEMLR-------GVP---------LFAGTTDIEQLAIIIRTL 225
            ||:|||.:.|..|||:|:...::::..:       .||         :.:..:|...:..|...|
Yeast   212 PEVLFGVKCYDGGVDVWSLLIIISQWFQRETSRMGHVPAMIDDGSDDMNSDGSDFRLICSIFEKL 276

  Fly   226 GSPRLNQWPEL 236
            |.|.:.:|.|:
Yeast   277 GIPSIQKWEEV 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 67/272 (25%)
S_TKc 9..288 CDD:214567 67/272 (25%)
CAK1NP_116624.1 PKc_like 28..279 CDD:304357 64/262 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110939443
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.