DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and CDKD1;1

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_177510.1 Gene:CDKD1;1 AraportID:AT1G73690 Length:398 Species:Arabidopsis thaliana

Alignment Length:280 Identity:106/281 (38%)
Similarity:167/281 (59%) Gaps:5/281 (2%)


  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDII 72
            ||...|.:|:|.:|.||||.|.:..:.|||||:.|..:...:.:..|||||.|:..|..:|:::|
plant    10 RYLKREVLGQGTYGVVFKATDTKNGETVAIKKIRLGKEKEGVNVTALREIKLLKELKHPHIIELI 74

  Fly    73 DIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPANL 137
            |.:|....|.:|.|:....|...::.....||...|:.:...:.||:.|.|...::|||:||.||
plant    75 DAFPHKENLHIVFEFMETDLEAVIRDRNLYLSPGDVKSYLQMILKGLEYCHGKWVLHRDMKPNNL 139

  Fly   138 LISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVAEM 202
            ||.....||:|||||||::  ....|.::.||..|||||||:|||:::|...||:|||||:.||:
plant   140 LIGPNGQLKLADFGLARIF--GSPGRKFTHQVFARWYRAPELLFGAKQYDGAVDVWAAGCIFAEL 202

  Fly   203 LRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTHAVE 267
            |...|...|.:||:||:.|....|:|:.:|||::..||||.:.:|..:..:.  :|.|:.:... 
plant   203 LLRRPFLQGNSDIDQLSKIFAAFGTPKADQWPDMICLPDYVEYQFVPAPSLR--SLLPTVSEDA- 264

  Fly   268 INLVSNLVVYNPKNRLKASE 287
            ::|:|.:..|:||:|:...:
plant   265 LDLLSKMFTYDPKSRISIQQ 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 106/281 (38%)
S_TKc 9..288 CDD:214567 105/280 (38%)
CDKD1;1NP_177510.1 PLN00009 9..291 CDD:177649 106/281 (38%)
STKc_CDK7 10..304 CDD:270833 106/281 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1367115at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.