DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and CAK4

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_176847.1 Gene:CAK4 AraportID:AT1G66750 Length:348 Species:Arabidopsis thaliana

Alignment Length:276 Identity:106/277 (38%)
Similarity:167/277 (60%) Gaps:5/277 (2%)


  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDII 72
            ||...:.:|||.:|.|:||.|.:..|.||:||:.|.|:...:....|||||.|:.....:|:::|
plant    12 RYLRRQILGEGTYGVVYKATDTKTGKTVAVKKIRLGNQKEGVNFTALREIKLLKELNHPHIVELI 76

  Fly    73 DIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPANL 137
            |.:|....|.||.||....|...::.....||...::.:.....||:||.|:..::|||:||.||
plant    77 DAFPHDGSLHLVFEYMQTDLEAVIRDRNIFLSPGDIKSYMLMTLKGLAYCHKKWVLHRDMKPNNL 141

  Fly   138 LISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVAEM 202
            ||.:..:||:||||||||:  ...:|.::.||...||||||:||||::||.|||:|||||:.||:
plant   142 LIGENGLLKLADFGLARLF--GSPNRRFTHQVFATWYRAPELLFGSRQYGAGVDVWAAGCIFAEL 204

  Fly   203 LRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTHAVE 267
            |...|...|:|:|:||..|.:..|:|..:||.::..||||.:..:..:..:.  .:||..:... 
plant   205 LLRRPFLPGSTEIDQLGKIFQAFGTPVPSQWSDMIYLPDYMEFSYTPAPPLR--TIFPMASDDA- 266

  Fly   268 INLVSNLVVYNPKNRL 283
            ::|::.:.:|:|:.|:
plant   267 LDLLAKMFIYDPRQRI 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 106/277 (38%)
S_TKc 9..288 CDD:214567 105/276 (38%)
CAK4NP_176847.1 STKc_CDK7 12..305 CDD:270833 106/277 (38%)
PTZ00024 19..305 CDD:240233 104/270 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1367115at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.