DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and CDKD1;3

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_173244.1 Gene:CDKD1;3 AraportID:AT1G18040 Length:391 Species:Arabidopsis thaliana

Alignment Length:280 Identity:110/281 (39%)
Similarity:169/281 (60%) Gaps:5/281 (2%)


  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDII 72
            ||...|.:|:|.:|.||||.|.:..:.|||||:.|..:...:.:..|||||.|:..|..:|:.:|
plant    11 RYLKQEVLGQGTYGVVFKATDTKTEQTVAIKKIRLGKQREGVNITALREIKMLKELKHPHIILLI 75

  Fly    73 DIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPANL 137
            |.:|....|.||.|:....|...::.....||...::.:....|||:||.|:..::|||:||.||
plant    76 DAFPHKENLHLVFEFMETDLEAVIRDSNIFLSPADIKSYLLMTFKGLAYCHDKWVLHRDMKPNNL 140

  Fly   138 LISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVAEM 202
            ||.....||:|||||||::  ...:|.::.||..|||||||:|||:::||..||:||..|:.||:
plant   141 LIGVDGQLKLADFGLARIF--GSPNRKFTHQVFARWYRAPELLFGAKQYGAAVDVWAVACIFAEL 203

  Fly   203 LRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTHAVE 267
            |...|...|.:||:||:.|....|:|:.:|||:||.||||.:.:|..:..:.  :|||:.:... 
plant   204 LLRRPFLQGNSDIDQLSKIFAAFGTPKADQWPDLTKLPDYVEYQFVPAPSLR--SLFPAVSDDA- 265

  Fly   268 INLVSNLVVYNPKNRLKASE 287
            ::|:|.:..|:||.|:...:
plant   266 LDLLSKMFTYDPKARISIKQ 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 110/281 (39%)
S_TKc 9..288 CDD:214567 109/280 (39%)
CDKD1;3NP_173244.1 STKc_CDK7 11..305 CDD:270833 110/281 (39%)
PTZ00024 18..305 CDD:240233 107/274 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1367115at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.