DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and CAK1AT

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001329562.1 Gene:CAK1AT AraportID:AT4G28980 Length:479 Species:Arabidopsis thaliana

Alignment Length:413 Identity:97/414 (23%)
Similarity:160/414 (39%) Gaps:150/414 (36%)


  Fly     7 SRYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKV-ALKNKFGNIALNTLREIKTLQLCKSEYILD 70
            ::|::.|::|.|.:..|::|..|.....||:|:: ..::.|        |||..|.:......:.
plant    19 AKYEIFERVGSGAYADVYRARRLSDGLIVALKEIFDYQSAF--------REIDALTILNGSPNVV 75

  Fly    71 IIDIY--PDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQ----------------QVRKFAHQMFK 117
            ::..|  .:.....||||:        |:|::..:.|.                :::::..|:..
plant    76 VMHEYFWREEENAVLVLEF--------LRSDLAAVIRDGKRKKKVEGGDGFSVGEIKRWMIQILT 132

  Fly   118 GIAYLHEAGLMHRDIKPANLLISDTDMLKIADFGLARL--------------------------- 155
            |:...|...::|||:||.|:||||..:||:||||.||:                           
plant   133 GVDACHRNLIVHRDLKPGNMLISDDGVLKLADFGQARILMEHDIVASDENQQAYKLEDKDGETSE 197

  Fly   156 ----------------------------YF----------------------------------- 157
                                        ||                                   
plant   198 PPEVIPDYENSPRQGSDGQEREAMSKDEYFRQVEELKAKQVVRDDTDKDSNVHDGDISCLATCTV 262

  Fly   158 -------------------PEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVAEML 203
                               .:|...|.:..|.|||:|.||:|:||..||..||:|:.|||.||:|
plant   263 SEMDDDLGRNSFSYDADEAVDDTQGLMTSCVGTRWFRPPELLYGSTMYGLEVDLWSLGCVFAELL 327

  Fly   204 RGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRF---PNSVGIHWDNLFPSCTHA 265
            ...|||.|.:||:|::.:...||:.....||....||||..|.|   .:.:||  :...|:.:..
plant   328 SLEPLFPGISDIDQISRVTNVLGNLNEEVWPGCVDLPDYKSISFAKVESPLGI--EGCLPNHSGD 390

  Fly   266 VEINLVSNLVVYNPKNRLKASEV 288
            | |:|:..|:.|:|.:|....|:
plant   391 V-ISLLKKLICYDPASRATTMEM 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 97/413 (23%)
S_TKc 9..288 CDD:214567 97/410 (24%)
CAK1ATNP_001329562.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24056
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.