| Sequence 1: | NP_650984.1 | Gene: | CG6800 / 42562 | FlyBaseID: | FBgn0038902 | Length: | 302 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001329562.1 | Gene: | CAK1AT / 829019 | AraportID: | AT4G28980 | Length: | 479 | Species: | Arabidopsis thaliana | 
| Alignment Length: | 413 | Identity: | 97/413 - (23%) | 
|---|---|---|---|
| Similarity: | 160/413 - (38%) | Gaps: | 150/413 - (36%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     7 SRYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKV-ALKNKFGNIALNTLREIKTLQLCKSEYILD 70 
  Fly    71 IIDIY--PDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQ----------------QVRKFAHQMFK 117 
  Fly   118 GIAYLHEAGLMHRDIKPANLLISDTDMLKIADFGLARL--------------------------- 155 
  Fly   156 ----------------------------YF----------------------------------- 157 
  Fly   158 -------------------PEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVAEML 203 
  Fly   204 RGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRF---PNSVGIHWDNLFPSCTHA 265 
  Fly   266 VEINLVSNLVVYNPKNRLKASEV 288 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG6800 | NP_650984.1 | STKc_CCRK | 8..295 | CDD:270826 | 97/412 (24%) | 
| S_TKc | 9..288 | CDD:214567 | 96/409 (23%) | ||
| CAK1AT | NP_001329562.1 | PKc_like | 20..430 | CDD:419665 | 97/412 (24%) | 
| PKc_like | <141..>210 | CDD:419665 | 18/68 (26%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | LDO | PTHR24056 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.100 | |||||