DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and MHK

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001031622.1 Gene:MHK AraportID:AT4G13020 Length:444 Species:Arabidopsis thaliana

Alignment Length:285 Identity:107/286 (37%)
Similarity:161/286 (56%) Gaps:16/286 (6%)


  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDII 72
            |||:||::|:|..|.|:||::|:..:.||:||:..|..:....:| |||:|.|:.....:|:.:.
plant    11 RYKILEELGDGTCGSVYKAVNLETYEVVAVKKMKRKFYYWEECVN-LREVKALRKLNHPHIIKLK 74

  Fly    73 DIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPANL 137
            :|..:...|..:.|.....||:.:|....|.|..::|.|..||.:|:|::|:.|..|||:||.||
plant    75 EIVREHNELFFIFECMDHNLYHIMKERERPFSEGEIRSFMSQMLQGLAHMHKNGYFHRDLKPENL 139

  Fly   138 LISDTDMLKIADFGLAR--LYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVA 200
            |::: ::||||||||||  ...|.     |:..||||||||||:|..|..|...|||||.|.::|
plant   140 LVTN-NILKIADFGLAREVASMPP-----YTEYVSTRWYRAPEVLLQSSLYTPAVDMWAVGAILA 198

  Fly   201 EMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLP---DYSKIRFPNSVGIHWDNLFPSC 262
            |:....|||.|.::|:||..|...||.|....:||..|:.   ..|...||.:   ...:|.|:.
plant   199 ELYALTPLFPGESEIDQLYKICCVLGKPDWTTFPEAKSISRIMSISHTEFPQT---RIADLLPNA 260

  Fly   263 THAVEINLVSNLVVYNPKNRLKASE 287
            .... |:|::.|..::|..|..|.|
plant   261 APEA-IDLINRLCSWDPLKRPTADE 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 107/286 (37%)
S_TKc 9..288 CDD:214567 106/285 (37%)
MHKNP_001031622.1 STKc_MAK_like 12..291 CDD:270824 106/285 (37%)
S_TKc 12..291 CDD:214567 106/285 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.