DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and cdk7

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001017219.1 Gene:cdk7 XenbaseID:XB-GENE-485507 Length:352 Species:Xenopus tropicalis

Alignment Length:283 Identity:108/284 (38%)
Similarity:167/284 (59%) Gaps:8/284 (3%)


  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKF---GNIALNTLREIKTLQLCKSEYIL 69
            :|:.||.:|||....|:||.|...::.|||||:.|.::.   ..|....|||||.||......|:
 Frog    17 QYEKLEFLGEGQFATVYKARDKNTDRIVAIKKIKLGHRAEAKDGINRTALREIKLLQELSHPNII 81

  Fly    70 DIIDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKP 134
            .::|.:...:.:|||.::....|...:|.....|:...::.:.....:|:.|||...::|||:||
 Frog    82 GLLDAFGHKSNISLVFDFMETDLEVIIKDTSLVLTPAHIKSYMLMTLQGLEYLHHLWILHRDLKP 146

  Fly   135 ANLLISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVV 199
            .|||:.:..:||:||||||:.:  ...:|:|:.||.|||||:||:|||::.||.||||||.||::
 Frog   147 NNLLLDENGVLKLADFGLAKSF--GSPNRIYTHQVVTRWYRSPELLFGARMYGVGVDMWAVGCIL 209

  Fly   200 AEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTH 264
            ||:|..||...|.:|::||..|..|||:|...|||.::|||||  :.|.:..|....::|.:...
 Frog   210 AELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPGMSSLPDY--VAFKSFPGTPLHHIFIAAGD 272

  Fly   265 AVEINLVSNLVVYNPKNRLKASE 287
            .: :.|:..|..:||..|..||:
 Frog   273 DL-LELLQGLFTFNPCARCTASQ 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 108/284 (38%)
S_TKc 9..288 CDD:214567 108/283 (38%)
cdk7NP_001017219.1 PTZ00024 12..314 CDD:240233 108/284 (38%)
STKc_CDK7 17..314 CDD:270833 108/284 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0659
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1367115at2759
OrthoFinder 1 1.000 FOG0001496
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.