DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and cdk20

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_009302023.1 Gene:cdk20 ZFINID:ZDB-GENE-041212-84 Length:359 Species:Danio rerio

Alignment Length:281 Identity:131/282 (46%)
Similarity:181/282 (64%) Gaps:3/282 (1%)


  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQ-LCKSEYILDI 71
            :|.:|.:||||.||.||||..::..:.||:|||||:.....|....|||||.|| :..::|::.:
Zfish    18 QYSILGRIGEGAHGIVFKAKHIETGETVALKKVALRRLEDGIPNQALREIKALQEIEDNQYVVKL 82

  Fly    72 IDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPAN 136
            .|::|..||..||.||....|...:::...||:..||:.:...:.||:|:.||..:||||:||||
Zfish    83 KDVFPHGTGFVLVFEYMLSDLSEVIRNSQRPLTASQVKSYMMMLLKGVAFCHENSIMHRDLKPAN 147

  Fly   137 LLISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVAE 201
            ||||.|..||||||||||| |..:..||||.||:||||||||:|:|::||..|||:||.||:..|
Zfish   148 LLISSTGHLKIADFGLARL-FSNEGDRLYSHQVATRWYRAPELLYGARKYDEGVDLWAVGCIFGE 211

  Fly   202 MLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTHAV 266
            :|...|||.|..|||||..::|.||:|....|||:|.||||:||.|..:..|..:.:.|. |...
Zfish   212 LLNNSPLFPGENDIEQLCCVLRVLGTPNQKVWPEITELPDYNKITFKENPPIPLEEIVPD-TSPQ 275

  Fly   267 EINLVSNLVVYNPKNRLKASE 287
            .::|:...:||..|.|:.|.:
Zfish   276 AVDLLKKFLVYPSKQRISARQ 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 131/282 (46%)
S_TKc 9..288 CDD:214567 131/281 (47%)
cdk20XP_009302023.1 PLN00009 16..303 CDD:177649 131/282 (46%)
STKc_CCRK 18..304 CDD:270826 131/282 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4666816
eggNOG 1 0.900 E1_KOG0659
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H8109
Inparanoid 1 1.050 259 1.000 Inparanoid score I3048
OMA 1 1.010
OrthoDB 1 1.010 D1367115at2759
OrthoFinder 1 1.000 FOG0001496
OrthoInspector 1 1.000 T1053172
orthoMCL 1 0.900 OOG5_133954
Panther 1 1.100 LDO PTHR24056
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5375
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.