| Sequence 1: | NP_650984.1 | Gene: | CG6800 / 42562 | FlyBaseID: | FBgn0038902 | Length: | 302 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_998126.2 | Gene: | cdk7 / 405897 | ZFINID: | ZDB-GENE-010320-2 | Length: | 345 | Species: | Danio rerio | 
| Alignment Length: | 284 | Identity: | 109/284 - (38%) | 
|---|---|---|---|
| Similarity: | 166/284 - (58%) | Gaps: | 10/284 - (3%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKF---GNIALNTLREIKTLQLCKSEYIL 69 
  Fly    70 DIIDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKP 134 
  Fly   135 ANLLISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVV 199 
  Fly   200 AEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIR-FPNSVGIHWDNLFPSCT 263 
  Fly   264 HAVEINLVSNLVVYNPKNRLKASE 287  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG6800 | NP_650984.1 | STKc_CCRK | 8..295 | CDD:270826 | 109/284 (38%) | 
| S_TKc | 9..288 | CDD:214567 | 108/283 (38%) | ||
| cdk7 | NP_998126.2 | PTZ00024 | 7..308 | CDD:240233 | 109/284 (38%) | 
| STKc_CDK7 | 11..308 | CDD:270833 | 109/284 (38%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0659 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1367115at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.820 | |||||