DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and Pitslre

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_649251.2 Gene:Pitslre FlyBaseID:FBgn0016696 Length:952 Species:Drosophila melanogaster

Alignment Length:311 Identity:101/312 (32%)
Similarity:166/312 (53%) Gaps:36/312 (12%)


  Fly     1 MEDYAP--------SRYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREI 57
            :.:|.|        ..::.|.:|.||.:|.|::|.|.:.|:.||:|::.::.:.....:.:||||
  Fly   542 LPNYYPGVQGCRSVEEFQCLNRIEEGTYGVVYRAKDKRTNEIVALKRLKMEKEKEGFPITSLREI 606

  Fly    58 KTLQLCKSEYILDIIDIY--PDLTGLSLVLEYQP-------DTLYNRLKS----EVNPLSRQQVR 109
            .||...:...|:.:.:|.  .::..:.:|::|..       :|:.||.:|    ||..|::|.:|
  Fly   607 NTLLKGQHPNIVTVREIVVGSNMDKIFIVMDYVEHDLKSLMETMKNRKQSFFPGEVKCLTQQLLR 671

  Fly   110 KFAHQMFKGIAYLHEAGLMHRDIKPANLLISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWY 174
            ..||        ||:..::|||:|.:|||:|...:||:.||||||.|  ....:.|:..|.|.||
  Fly   672 AVAH--------LHDNWILHRDLKTSNLLLSHKGILKVGDFGLAREY--GSPIKKYTSLVVTLWY 726

  Fly   175 RAPEILFGSQKYGTGVDMWAAGCVVAEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSL 239
            ||||:|..|..|.|.:|:|:.||:.||.|:.:|||.|.::|::|..|.:.||:|....||..|.|
  Fly   727 RAPELLLCSPVYSTPIDVWSVGCIFAEFLQMLPLFPGKSEIDELNRIFKELGTPNEKIWPGYTEL 791

  Fly   240 PDYSKIRFPNSVGIHWD-----NLFPSCTHAVEINLVSNLVVYNPKNRLKA 285
            |....:...||....:.     ..|...|..:.::|:..|:.|:||.||.|
  Fly   792 PAVKNMLSQNSQFTEYPVSQLRKHFQEKTSEMGLSLLQGLLTYDPKQRLSA 842

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 99/297 (33%)
S_TKc 9..288 CDD:214567 99/296 (33%)
PitslreNP_649251.2 STKc_CDC2L1 552..851 CDD:173741 99/302 (33%)
PLN00009 555..854 CDD:177649 99/299 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110957555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24056
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.