DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and Cdk8

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_536735.2 Gene:Cdk8 FlyBaseID:FBgn0015618 Length:454 Species:Drosophila melanogaster

Alignment Length:321 Identity:92/322 (29%)
Similarity:157/322 (49%) Gaps:65/322 (20%)


  Fly    14 KIGEGVHGCVFKAIDLQRNKEVAI-KKVALKNKFG-NIALNTLREIKTLQLCKSEYILDIIDIYP 76
            |:|.|.:|.|:||    :.||.:. |:.|||...| .::::..|||..|:..|.:.::.:|.:: 
  Fly    26 KVGRGTYGHVYKA----KWKETSDGKEYALKQIDGTGLSMSACREIALLRELKHQNVITLIRVF- 85

  Fly    77 DLTGLS-------LVLEYQPDTLYNRL----------KSEVNPLSRQQVRKFAHQMFKGIAYLHE 124
                ||       |:::|....|::.:          |..|.|  |..|:...:|:..||.|||.
  Fly    86 ----LSHNDRKVFLLIDYAEHDLWHIIKFHRAAKATKKQVVVP--RGMVKSLLYQILDGIHYLHS 144

  Fly   125 AGLMHRDIKPANLLI----SDTDMLKIADFGLARLY-FPEDESRLYSPQVSTRWYRAPEILFGSQ 184
            ..::|||:||||:|:    ::...:||||.|.|||: .|........|.|.|.||||||:|.|::
  Fly   145 NWVLHRDLKPANILVMGDGNERGRVKIADMGFARLFNAPLKPLADLDPVVVTFWYRAPELLLGAR 209

  Fly   185 KYGTGVDMWAAGCVVAEMLRGVPLF-AGTTDI--------EQLAIIIRTLGSPRLNQWPELTSLP 240
            .|...:|:||.||:.||:|...|:| ....||        :||..|...:|.|:...|.::..:|
  Fly   210 HYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPQDKDWEDIKKMP 274

  Fly   241 DYSKIR--FPNSVGIHWDNLFPSCT-------HAVE-----INLVSNLVVYNPKNRLKASE 287
            ::..:.  |..|.       :.:|:       |.::     .:|:..|::.:|..|:.:.:
  Fly   275 EHHTLTKDFKRST-------YSTCSLAKYMERHKIKPDSKAFHLLQKLLLMDPNKRITSEQ 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 92/322 (29%)
S_TKc 9..288 CDD:214567 92/322 (29%)
Cdk8NP_536735.2 STKc_CDK8_like 19..335 CDD:270834 92/322 (29%)
S_TKc 22..335 CDD:214567 92/322 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110897493
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24056
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.