DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and Eip63E

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001261373.1 Gene:Eip63E FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster

Alignment Length:285 Identity:103/286 (36%)
Similarity:151/286 (53%) Gaps:13/286 (5%)


  Fly     9 YKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDIID 73
            |..||.:|||.:..|:|.......:.||:|::.|:.:.| .....:||...|:..|...|:.:.|
  Fly   205 YVKLEPLGEGSYATVYKGFSKLTYQRVALKEIRLQEEEG-APFTAIREASLLKELKHSNIVTLHD 268

  Fly    74 IYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPANLL 138
            |......|:.|.||....|...::.....|..:.||.|..|:.:|::|.|:..::|||:||.|||
  Fly   269 IVHTRETLTFVFEYVNTDLSQYMEKHPGGLDHRNVRLFLFQLLRGLSYCHKRRVLHRDVKPQNLL 333

  Fly   139 ISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVAEML 203
            |||...||:|||||||.  ....|..||.:|.|.|||.|::|.||.:|.|.:|||..||:..||:
  Fly   334 ISDCGELKLADFGLARA--KSVPSHTYSHEVVTLWYRPPDVLLGSTEYSTSLDMWGVGCIFVEMV 396

  Fly   204 RGVPLFAGTTD-IEQLAIIIRTLGSPRLNQWPELTSLPDYS--KIRF--PNSVGIHWDNLFPSCT 263
            .|:|.|.|..| .:||..|.:.||:|..:.||.:|..|.|.  |:.|  |..:|    :.||...
  Fly   397 TGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGVTHFPGYKPHKLGFYRPRKLG----HNFPRLY 457

  Fly   264 HAVEINLVSN-LVVYNPKNRLKASE 287
            ..:|...::| .:..||:.||.|.:
  Fly   458 DIIEGETIANGFLQLNPEQRLGADD 482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 103/286 (36%)
S_TKc 9..288 CDD:214567 103/286 (36%)
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 103/286 (36%)
STKc_PCTAIRE_like 204..489 CDD:270835 103/286 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110932648
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24056
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.