| Sequence 1: | NP_650984.1 | Gene: | CG6800 / 42562 | FlyBaseID: | FBgn0038902 | Length: | 302 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001286884.1 | Gene: | CG7028 / 38032 | FlyBaseID: | FBgn0027587 | Length: | 912 | Species: | Drosophila melanogaster | 
| Alignment Length: | 228 | Identity: | 67/228 - (29%) | 
|---|---|---|---|
| Similarity: | 107/228 - (46%) | Gaps: | 14/228 - (6%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     7 SRYKMLEKIGEGVHGCVFKAIDLQRNK-EVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILD 70 
  Fly    71 IIDIYPDL---TGLSLVLEYQPDTLYNRLK---SEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMH 129 
  Fly   130 RDIKPANLLISDTDM-LKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMW 193 
  Fly   194 AAGCVVAEMLRGVPLFAGTTDIEQLAIIIRTLG 226 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG6800 | NP_650984.1 | STKc_CCRK | 8..295 | CDD:270826 | 67/227 (30%) | 
| S_TKc | 9..288 | CDD:214567 | 66/226 (29%) | ||
| CG7028 | NP_001286884.1 | STKc_PRP4 | 591..908 | CDD:271037 | 67/227 (30%) | 
| S_TKc | 599..908 | CDD:214567 | 65/219 (30%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45442433 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24056 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.030 | |||||