DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and Cdk9

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_477226.2 Gene:Cdk9 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster

Alignment Length:303 Identity:107/304 (35%)
Similarity:165/304 (54%) Gaps:18/304 (6%)


  Fly     1 MEDY------APSRYKMLEKIGEGVHGCVFKAIDLQRNKE-VAIKKVALKNKFGNIALNTLREIK 58
            :|||      ..::|:.:.|||:|..|.||||.:.:.||: ||:|||.:.|:.....:..||||:
  Fly    36 IEDYDFPYCDESNKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIR 100

  Fly    59 TLQLCKSEYILDIIDIYPDLTGLS--------LVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQM 115
            .|||.|.|.::::|:|.......:        ||.::....|...|.:.....|..:::|...|:
  Fly   101 ILQLLKHENVVNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQL 165

  Fly   116 FKGIAYLHEAGLMHRDIKPANLLISDTDMLKIADFGLARLY-FPEDESR-LYSPQVSTRWYRAPE 178
            ..|:.|:|...::|||:|.||:||:...:||:|||||||.: .|::||: .|:.:|.|.|||.||
  Fly   166 LNGLYYIHSNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPE 230

  Fly   179 ILFGSQKYGTGVDMWAAGCVVAEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYS 243
            :|.|.:.||..||||.|||::|||....|:..|.|:.:||..|.:..||...:.||.:..|..|.
  Fly   231 LLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYK 295

  Fly   244 KIRFP-NSVGIHWDNLFPSCTHAVEINLVSNLVVYNPKNRLKA 285
            .|..| |......:.|.|........:|:..|:..:||.|:.|
  Fly   296 SIELPKNQKRRVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDA 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 104/291 (36%)
S_TKc 9..288 CDD:214567 104/290 (36%)
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 107/303 (35%)
S_TKc 50..347 CDD:214567 104/290 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110910562
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24056
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.