DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and Cdk5

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_477080.1 Gene:Cdk5 FlyBaseID:FBgn0013762 Length:294 Species:Drosophila melanogaster

Alignment Length:285 Identity:106/286 (37%)
Similarity:160/286 (56%) Gaps:17/286 (6%)


  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKE----VAIKKVALKNKFGNIALNTLREIKTLQLCKSEYI 68
            :|..:||||||.:|.|||.    ||::    ||:|:|.|......:..:.||||..|:..|.:.|
  Fly     3 KYDKMEKIGEGTYGTVFKG----RNRDTMEIVALKRVRLDEDDEGVPSSALREICLLKELKHKNI 63

  Fly    69 LDIIDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIK 133
            :.:||:......|:||.|:....|.....|....:.....|.|..|:.:|:|:.|...::|||:|
  Fly    64 VRLIDVLHSDKKLTLVFEHCDQDLKKYFDSLNGEIDMAVCRSFMLQLLRGLAFCHSHNVLHRDLK 128

  Fly   134 PANLLISDTDMLKIADFGLARLY-FPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGC 197
            |.||||:....||:|||||||.: .|   .:.||.:|.|.|||.|::|||::.|.|.:|||:|||
  Fly   129 PQNLLINKNGELKLADFGLARAFGIP---VKCYSAEVVTLWYRPPDVLFGAKLYTTSIDMWSAGC 190

  Fly   198 VVAEML-RGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGI-HWDNLFP 260
            ::||:. .|.|||.|:..::||..|.|.||:|..:.||.::.|.||  :..|:...| .|..|.|
  Fly   191 ILAELADAGRPLFPGSDVLDQLMKIFRVLGTPNEDSWPGVSHLSDY--VALPSFPAITSWSQLVP 253

  Fly   261 SCTHAVEINLVSNLVVYNPKNRLKA 285
            . .::...:|:..|::..|..|:.|
  Fly   254 R-LNSKGRDLLQKLLICRPNQRISA 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 106/286 (37%)
S_TKc 9..288 CDD:214567 106/285 (37%)
Cdk5NP_477080.1 STKc_CDK5 3..286 CDD:143344 106/286 (37%)
PLN00009 1..288 CDD:177649 106/286 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C109364969
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24056
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.