DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and Cdk20

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001020923.2 Gene:Cdk20 RGDID:1305219 Length:346 Species:Rattus norvegicus

Alignment Length:281 Identity:123/282 (44%)
Similarity:181/282 (64%) Gaps:3/282 (1%)


  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQ-LCKSEYILDI 71
            :|.:|.:||||.||.||||..::..:.||:|||||:.....|....|||||.|| :..|:|::.:
  Rat     3 QYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGIPNQALREIKALQEIEDSQYVVQL 67

  Fly    72 IDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPAN 136
            ..::|...|..|..|:....|...::....||:..||:.:...:.||:|:.|...::|||:||||
  Rat    68 KAVFPHGAGFVLAFEFMLSDLAEVVRHAQRPLAPAQVKSYLQMLLKGVAFCHANNIVHRDLKPAN 132

  Fly   137 LLISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVAE 201
            ||||.:..||||||||||::.| |..|||:.||:||||||||:|:|:::|..|||:||.||::.|
  Rat   133 LLISASGQLKIADFGLARVFSP-DGGRLYTHQVATRWYRAPELLYGARQYDQGVDLWAVGCIMGE 196

  Fly   202 MLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTHAV 266
            :|.|.|||.|..|||||..::|.||:|....|||:|.||||:||.|.....:..:.:.|..:|..
  Rat   197 LLNGSPLFPGENDIEQLCCVLRILGTPSPRVWPEITELPDYNKISFKEQAPVPLEEVLPDASHQA 261

  Fly   267 EINLVSNLVVYNPKNRLKASE 287
             ::|:...::|.|:.|:.||:
  Rat   262 -LDLLGQFLLYPPRQRIAASQ 281

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 123/282 (44%)
S_TKc 9..288 CDD:214567 123/281 (44%)
Cdk20NP_001020923.2 STKc_CCRK 3..289 CDD:270826 123/282 (44%)
PTZ00024 10..301 CDD:240233 121/275 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4666657
eggNOG 1 0.900 E1_KOG0659
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H8109
Inparanoid 1 1.050 249 1.000 Inparanoid score I3107
OMA 1 1.010
OrthoDB 1 1.010 D1367115at2759
OrthoFinder 1 1.000 FOG0001496
OrthoInspector 1 1.000 T1087520
orthoMCL 1 0.900 OOG5_133954
Panther 1 1.100 LDO PTHR24056
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.