DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and Cdk1

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_476797.1 Gene:Cdk1 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster

Alignment Length:299 Identity:105/300 (35%)
Similarity:168/300 (56%) Gaps:29/300 (10%)


  Fly     1 MEDYAPSRYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKS 65
            |||     ::.:||||||.:|.|:|..:....:.||:||:.|::....:....:|||..|:..|.
  Fly     1 MED-----FEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKH 60

  Fly    66 EYILDIIDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPL------SRQQVRKFAHQMFKGIAYLHE 124
            |.|:.:.|:..:...:.|:.|:    |...||..::.|      ..:.||.:.:|:...|.:.|.
  Fly    61 ENIVCLEDVLMEENRIYLIFEF----LSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHR 121

  Fly   125 AGLMHRDIKPANLLISDTDMLKIADFGLARLY-FPEDESRLYSPQVSTRWYRAPEILFGSQKYGT 188
            ..::|||:||.||||..:.::|:|||||.|.: .|   .|:|:.::.|.||||||:|.||.:|..
  Fly   122 RRVLHRDLKPQNLLIDKSGLIKVADFGLGRSFGIP---VRIYTHEIVTLWYRAPEVLLGSPRYSC 183

  Fly   189 GVDMWAAGCVVAEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFP----N 249
            .||:|:.||:.|||....|||.|.::|:||..:.|.|.:|..:.||.:|||||| |..||    |
  Fly   184 PVDIWSIGCIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDY-KNTFPCWSTN 247

  Fly   250 SVGIHWDNLFPSCTHAVEINLVSNLVVYNPKNRLKASEV 288
            .:.....||     .|..|:|:..:::|:|.:|:.|.::
  Fly   248 QLTNQLKNL-----DANGIDLIQKMLIYDPVHRISAKDI 281

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 102/293 (35%)
S_TKc 9..288 CDD:214567 102/290 (35%)
Cdk1NP_476797.1 PLN00009 1..288 CDD:177649 105/300 (35%)
STKc_CDK1_euk 3..287 CDD:270845 103/298 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110871422
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24056
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.