DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and CG7236

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_608950.3 Gene:CG7236 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster

Alignment Length:234 Identity:85/235 (36%)
Similarity:133/235 (57%) Gaps:11/235 (5%)


  Fly     4 YAP------SRYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQL 62
            |.|      .||:.|.::|||.:|.|:|..|.:....||:|:.........|....||||:.|:.
  Fly    39 YRPQGSSKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKN 103

  Fly    63 CKSEYILDIIDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGL 127
            .|...::.:::::.....|.||.|:...|:.:.|:...........::..:|...|:||.|:.|.
  Fly   104 LKHPNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGC 168

  Fly   128 MHRDIKPANLLISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDM 192
            :||||||.|:|::....:|:.|||.||:..|.:.   |:..|:||||||||:|.|..:|||.||:
  Fly   169 LHRDIKPENILLTAQGQVKLCDFGFARMLSPGEN---YTDYVATRWYRAPELLVGDTQYGTPVDV 230

  Fly   193 WAAGCVVAEMLRGVPLFAGTTDIEQLAIIIRTLGS--PR 229
            ||.||:.||::||..|:.|.:|::||.:|.:|||.  ||
  Fly   231 WAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPR 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 83/225 (37%)
S_TKc 9..288 CDD:214567 82/224 (37%)
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 83/226 (37%)
Pkinase 50..335 CDD:278497 82/224 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110351856
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24056
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.