DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and csk1

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_593019.1 Gene:csk1 PomBaseID:SPAC1D4.06c Length:306 Species:Schizosaccharomyces pombe

Alignment Length:290 Identity:84/291 (29%)
Similarity:129/291 (44%) Gaps:59/291 (20%)


  Fly    19 VHGCVFK--AIDLQRNKEVA-------IKKVA---LKNKFGNIALNTLREIKTLQLCKSEYILDI 71
            |.|.|||  ..|..|.|.:.       |:::.   :.|:.|::.|.|        ..||..:.|:
pombe    41 VQGLVFKRPPHDAMRGKLILESIGHPHIERIVDSFIDNEAGSVYLIT--------SFKSFVLSDV 97

  Fly    72 IDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPAN 136
            :|            |...||..                |...|:...:.||.:.|::||||.|.|
pombe    98 MD------------EISIDTKC----------------KIVLQISSALEYLEKHGILHRDIHPNN 134

  Fly   137 LLI-SDTDMLKIADFGLA-RLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVV 199
            :|: |......::||.:| ....|.:|.:...||:.|..|||.|.|||...||..||.|..|.::
pombe   135 ILLDSMNGPAYLSDFSIAWSKQHPGEEVQELIPQIGTGHYRAIETLFGCHSYGHEVDRWTFGILI 199

  Fly   200 AEMLRGVPLF------AGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNL 258
            ||:.....||      ...:::...:.||:|||:|..:.||||::.||::|..|.......|..:
pombe   200 AELFSNQALFDDGSSEGWPSELRLTSSIIQTLGTPNPSMWPELSTFPDWNKFIFHEYPPKPWSEI 264

  Fly   259 FPSCTHAVEINLVSNLVVYNPKNRLKASEV 288
            .||...:::. :||:||.|:  ||...|.|
pombe   265 LPSVDTSIQY-IVSHLVTYS--NRASPSFV 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 84/291 (29%)
S_TKc 9..288 CDD:214567 83/289 (29%)
csk1NP_593019.1 S_TKc 12..247 CDD:214567 69/242 (29%)
PKc_like 14..269 CDD:304357 75/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.