DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and mcs6

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_596349.1 Gene:mcs6 PomBaseID:SPBC19F8.07 Length:335 Species:Schizosaccharomyces pombe

Alignment Length:281 Identity:95/282 (34%)
Similarity:160/282 (57%) Gaps:8/282 (3%)


  Fly     9 YKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDIID 73
            |....|:|||.:..||.....:.|:.|||||:.:......|.::.|||||.|:..:.:.:::::|
pombe    11 YVKERKVGEGTYAVVFLGRQKETNRRVAIKKIKVGQFKDGIDISALREIKFLRESRHDNVIELVD 75

  Fly    74 IYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPANLL 138
            ::...:.|:::||:....|...:|.:........::.:...:.:|:.::|...::|||:||.|||
pombe    76 VFSTKSNLNIILEFLDSDLEMLIKDKFIVFQPAHIKSWMVMLLRGLHHIHSRFILHRDLKPNNLL 140

  Fly   139 ISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVAEML 203
            ||...:||:|||||:|.:.....   .|.||.|||||.||:..|.:.||||||||:.||:.||::
pombe   141 ISSDGVLKLADFGLSRDFGTPSH---MSHQVITRWYRPPELFMGCRSYGTGVDMWSVGCIFAELM 202

  Fly   204 RGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRF--PNSVGIHWDNLFPSCTHAV 266
            ...|...|.:|::||.:|.|.||:|.......:..||:|.:::.  |.:.|:  :.||.:..|. 
pombe   203 LRTPYLPGESDLDQLNVIFRALGTPEPEVIKSMQQLPNYVEMKHIPPPNGGM--EALFSAAGHE- 264

  Fly   267 EINLVSNLVVYNPKNRLKASE 287
            ||:|:..::.|||..|..|.:
pombe   265 EIDLLKMMLDYNPYRRPTAQQ 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 95/282 (34%)
S_TKc 9..288 CDD:214567 95/282 (34%)
mcs6NP_596349.1 STKc_CDK7 11..305 CDD:270833 95/282 (34%)
Pkinase 11..292 CDD:278497 95/282 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001496
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.