DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and CDK20

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_016870050.1 Gene:CDK20 HGNCID:21420 Length:351 Species:Homo sapiens

Alignment Length:286 Identity:122/287 (43%)
Similarity:181/287 (63%) Gaps:8/287 (3%)


  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQ-LCKSEYILDI 71
            :|.:|.:||||.||.||||..::..:.||:|||||:..........|||||.|| :..::|::.:
Human     3 QYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQL 67

  Fly    72 IDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPAN 136
            ..::|...|..|..|:....|...::....||::.||:.:...:.||:|:.|...::|||:||||
Human    68 KAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPAN 132

  Fly   137 LLISDTDMLKIADFGLARLYFPEDESRLYSPQVST-----RWYRAPEILFGSQKYGTGVDMWAAG 196
            ||||.:..||||||||||::.| |.||||:.||:|     |||||||:|:|:::|..|||:|:.|
Human   133 LLISASGQLKIADFGLARVFSP-DGSRLYTHQVATSPLPRRWYRAPELLYGARQYDQGVDLWSVG 196

  Fly   197 CVVAEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPS 261
            |::.|:|.|.|||.|..|||||..::|.||:|....|||||.||||:||.|...|.:..:.:.|.
Human   197 CIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPD 261

  Fly   262 CTHAVEINLVSNLVVYNPKNRLKASE 287
            .:... ::|:...::|.|..|:.||:
Human   262 VSPQA-LDLLGQFLLYPPHQRIAASK 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 122/287 (43%)
S_TKc 9..288 CDD:214567 122/286 (43%)
CDK20XP_016870050.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4666725
eggNOG 1 0.900 E1_KOG0659
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H8109
Inparanoid 1 1.050 243 1.000 Inparanoid score I3266
Isobase 1 0.950 0 Normalized mean entropy S900
OMA 1 1.010
OrthoDB 1 1.010 D1367115at2759
OrthoFinder 1 1.000 FOG0001496
OrthoInspector 1 1.000 T1073884
orthoMCL 1 0.900 OOG5_133954
Panther 1 1.100 LDO PTHR24056
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5375
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.750

Return to query results.
Submit another query.