DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and dyf-18

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_502232.2 Gene:dyf-18 WormBaseID:WBGene00010349 Length:323 Species:Caenorhabditis elegans

Alignment Length:288 Identity:115/289 (40%)
Similarity:172/289 (60%) Gaps:17/289 (6%)


  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDII 72
            ||:.::..|.|..|.|..|.|...:|.||||::.:.| ...::|  .|||..|:......||.::
 Worm     7 RYETIQVAGRGAFGLVVIARDTLTSKRVAIKRIMVPN-VSKVSL--AREISCLRNLHHRNILKLL 68

  Fly    73 DIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPANL 137
            |.:|....:|:|.|..|.||.:.:|.:..|.:.|..|.:..|:..||||||...:|||||||.|:
 Worm    69 DCFPSADLMSIVTEEVPYTLGDIIKDKTRPKTEQFNRWYYTQILSGIAYLHSKEIMHRDIKPENI 133

  Fly   138 LISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVAEM 202
            |::..:::||||||.|..|.|:|.::.|...|:||||||||:||||:||...||:||.||::||:
 Worm   134 LVTSRNVVKIADFGQACFYMPKDPNQEYDVNVATRWYRAPELLFGSKKYKPDVDIWAIGCILAEL 198

  Fly   203 LRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRF-PNSVGIHWDNLFPSCTHAV 266
            :||.|:|.|.:::||::||...||:|..:.||...::||.:|:.| |.....:|..:. .|.   
 Worm   199 VRGKPIFPGRSELEQISIIFGVLGTPNEDNWPNWRTMPDANKLLFEPKEPRNNWTEIL-LCK--- 259

  Fly   267 EIN------LVSNLVVYNPKNRLKASEV 288
            ||:      |.|:|..:   .||||||:
 Worm   260 EISNNFTEFLGSHLQFF---KRLKASEL 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 115/289 (40%)
S_TKc 9..288 CDD:214567 114/286 (40%)
dyf-18NP_502232.2 PKc_like 7..289 CDD:304357 115/289 (40%)
S_TKc 8..290 CDD:214567 114/288 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110939479
eggNOG 1 0.900 E1_KOG0659
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I2431
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1367115at2759
OrthoFinder 1 1.000 FOG0001496
OrthoInspector 1 1.000 T475623
orthoMCL 1 0.900 OOG5_133954
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.660

Return to query results.
Submit another query.