DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and cdk-11.2

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_509746.2 Gene:cdk-11.2 WormBaseID:WBGene00013917 Length:668 Species:Caenorhabditis elegans

Alignment Length:294 Identity:93/295 (32%)
Similarity:159/295 (54%) Gaps:15/295 (5%)


  Fly     7 SRYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDI 71
            |.|.:|..|.||.:|.||:..:.:.::.||:|:..::.:.....:..||||.  .|.|:....:|
 Worm   302 SEYVILNVIAEGTYGEVFRGKNTRTDEVVALKRFKMEKEKEGFPITALREIN--MLLKAGAHENI 364

  Fly    72 IDIYPDLTG-----LSLVLEY---QPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLM 128
            :::...|.|     :.:.:||   ...:|.::::|........|.:....|:..||.::|:..::
 Worm   365 VNVKEILVGSTKTEVYMAMEYVEHDVKSLIDKMRSRNQRFKTGQQKTLMSQLLSGIEHMHKLWIL 429

  Fly   129 HRDIKPANLLISDTDMLKIADFGLARLY--FPEDESRL-YSPQVSTRWYRAPEILFGSQKYGTGV 190
            |||:|.:|||||.:.:||||||||||.|  ..:.|.|: .:|.|.|.|||:||:|...:.|.|.|
 Worm   430 HRDLKTSNLLISHSGILKIADFGLAREYGEARDIEKRMKLTPIVVTLWYRSPELLLEPKTYSTPV 494

  Fly   191 DMWAAGCVVAEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHW 255
            |||:.||::||.:...|:|.|.::..|:..|.:.:|:|....||::..|..::.:.||.......
 Worm   495 DMWSIGCIMAEFIMMKPMFQGDSEPNQVHQIFQMMGTPTEQIWPDIKELKVWNMVEFPPVKPGQL 559

  Fly   256 DNLF--PSCTHAVEINLVSNLVVYNPKNRLKASE 287
            ..:|  ....:....:|::.::..||.|||.|||
 Worm   560 RRIFKGEKLVNETGFDLLNGMLCLNPANRLTASE 593

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 92/294 (31%)
S_TKc 9..288 CDD:214567 92/293 (31%)
cdk-11.2NP_509746.2 PKc_like 298..600 CDD:304357 93/295 (32%)
S_TKc 304..600 CDD:214567 92/293 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110948969
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.