DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and cdk-8

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_492357.2 Gene:cdk-8 WormBaseID:WBGene00000409 Length:588 Species:Caenorhabditis elegans

Alignment Length:315 Identity:94/316 (30%)
Similarity:157/316 (50%) Gaps:43/316 (14%)


  Fly    13 EKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFG-NIALNTLREIKTLQLCKSEYILDIIDIYP 76
            ::||.|.:|.|:||:..::|.:...|:.|||...| ..:::..|||...:..:...::.:..:: 
 Worm    30 KEIGRGTYGLVYKAVPKKQNGQFPNKEYALKMIEGQGFSMSACREIALFRELRHPNLICLQRVF- 93

  Fly    77 DLTG---LSLVLEYQPDTLYNRL------KSEVNPL--SRQQVRKFAHQMFKGIAYLHEAGLMHR 130
             ||.   :.|:|:|....|::.:      ||:..|:  .|..|:....|:..|:.|||...::||
 Worm    94 -LTNEKKVWLLLDYAEHDLWHVIKHHRTAKSKKVPIMVPRNMVKNILFQILSGMHYLHSNWVLHR 157

  Fly   131 DIKPANLLI---SDTDM---LKIADFGLARLYF-PEDESRLYSPQVSTRWYRAPEILFGSQKYGT 188
            |:||||:|:   ...||   :||||.|.:|:|. |........|.|.|.||||||:|.|::.|..
 Worm   158 DLKPANILLMGDGPPDMRGRVKIADLGFSRIYANPLKPMAELDPVVVTFWYRAPELLLGAKHYTK 222

  Fly   189 GVDMWAAGCVVAEMLRGVPL-FAGTTDI--------EQLAIIIRTLGSPRLNQWPELTSLPDYSK 244
            .:|:||.||:.||:|...|| |....||        :|:..|...||.|....||::..:||:.:
 Worm   223 AIDVWAIGCIFAELLTAEPLFFCKEEDIKAQNPYHYDQVKRIFHLLGYPSDADWPDMKKMPDHQR 287

  Fly   245 I------------RFPNSVGIHWDNLFPSCTHAVEINLVSNLVVYNPKNRLKASE 287
            :            .||||:..::|. :...:.:....|:..|:..:|..|:...|
 Worm   288 LLSDARNEGTPIQTFPNSLHRYFDK-WKINSQSSPYRLLVKLLTVDPTKRVSCEE 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 94/316 (30%)
S_TKc 9..288 CDD:214567 94/316 (30%)
cdk-8NP_492357.2 STKc_CDK8_like 26..348 CDD:270834 94/316 (30%)
S_TKc 26..348 CDD:214567 94/316 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110032559
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.