DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and cdk-7

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_490952.2 Gene:cdk-7 WormBaseID:WBGene00000408 Length:330 Species:Caenorhabditis elegans

Alignment Length:283 Identity:96/284 (34%)
Similarity:160/284 (56%) Gaps:7/284 (2%)


  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNK---FGNIALNTLREIKTLQLCKSEYIL 69
            ||..::.:|||....|:.|.||:..:.|||||:.|.::   ...|....:||||.|:....:.|:
 Worm     4 RYDTIKHLGEGQFANVYLAQDLESGECVAIKKIKLGSREEAKDGINRTAIREIKLLKEIHHDNII 68

  Fly    70 DIIDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKP 134
            .:.|:....|.:.||.::....|.:.:|.:...|....::....||..|:.:||...::|||:||
 Worm    69 GLRDVIGHRTSIQLVFDFMDTDLEHVIKDKEIILMPAHIKNITMQMLLGLEFLHVHWILHRDLKP 133

  Fly   135 ANLLISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVV 199
            .|||::....:|:.||||||.:  ...:|.|:.||.||||||||:|||::.||.|:|:|:.||::
 Worm   134 NNLLMNKMGRVKLTDFGLARFF--GSPNRNYTHQVVTRWYRAPELLFGARSYGVGIDIWSVGCII 196

  Fly   200 AEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTH 264
            ||:|...|:|.|.:||:||..|...||.|....||.:|.:..|..|: |.:..:..:..|.:...
 Worm   197 AELLLRNPIFPGESDIDQLVKIFNILGCPTPETWPNMTEMNSYVIIK-PQTEYMALNYYFSAAPQ 260

  Fly   265 AVEINLVSNLVVYNPKNRLKASE 287
            .: ::|::.:..::|..||..::
 Worm   261 DL-LDLMAGMWTFDPIKRLTCTQ 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 96/284 (34%)
S_TKc 9..288 CDD:214567 95/283 (34%)
cdk-7NP_490952.2 PTZ00024 1..303 CDD:240233 96/284 (34%)
STKc_CDK7 4..302 CDD:270833 96/284 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1367115at2759
OrthoFinder 1 1.000 FOG0001496
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.