DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6800 and Cdk7

Sequence 1:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_008773277.1 Gene:Cdk7 RGDID:621124 Length:346 Species:Rattus norvegicus

Alignment Length:283 Identity:111/284 (39%)
Similarity:170/284 (60%) Gaps:8/284 (3%)


  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKF---GNIALNTLREIKTLQLCKSEYIL 69
            ||:.|:.:|||....|:||.|...|:.|||||:.|.::.   ..|....|||||.||......|:
  Rat    11 RYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNII 75

  Fly    70 DIIDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKP 134
            .::|.:...:.:|||.::....|...:|.....|:...::.:.....:|:.|||:..::|||:||
  Rat    76 GLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKP 140

  Fly   135 ANLLISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVV 199
            .|||:.:..:||:||||||:.:  ...:|.|:.||.||||||||:|||::.||.||||||.||::
  Rat   141 NNLLLDENGVLKLADFGLAKSF--GSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCIL 203

  Fly   200 AEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTH 264
            ||:|..||...|.:|::||..|..|||:|...|||::.|||||  :.|.:..||...::|.:...
  Rat   204 AELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDY--VTFKSFPGIPLQHIFIAAGD 266

  Fly   265 AVEINLVSNLVVYNPKNRLKASE 287
            .: :.|:..|.::||..|:.||:
  Rat   267 DL-LELIQGLFLFNPCTRITASQ 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 111/284 (39%)
S_TKc 9..288 CDD:214567 110/283 (39%)
Cdk7XP_008773277.1 PTZ00024 7..308 CDD:240233 111/284 (39%)
STKc_CDK7 11..308 CDD:270833 111/284 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0659
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1367115at2759
OrthoFinder 1 1.000 FOG0001496
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.