DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Burs and Muc5b

Sequence 1:NP_650983.1 Gene:Burs FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_083077.2 Gene:Muc5b MGIID:1921430 Length:4800 Species:Mus musculus

Alignment Length:100 Identity:33/100 (33%)
Similarity:49/100 (49%) Gaps:8/100 (8%)


  Fly    52 CQVTPVIHVLQYPGCVPKPIPSFACVGRCASYIQVSGSKIWQMERSCMCCQESGEREAAVSLFCP 116
            |||.....||:|.||..:...:| |.|.|:...:.| .:...|||.|.|||||...:.||::.||
Mouse  4706 CQVHVNATVLRYKGCETEVNITF-CEGSCSGISKYS-MEAQAMERQCTCCQESKVHDVAVTMQCP 4768

  Fly   117 KVKPGERKFKKVLTKAPLECMCRP-CTSIEESGII 150
            .....:..:..:     .||.|.| |:|:..:.:|
Mouse  4769 DGTVIQHTYTHI-----DECNCAPACSSLPGTSMI 4798

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 GHB_like 50..138 CDD:304424 28/86 (33%)
Muc5bNP_083077.2 VWD 80..227 CDD:214566
C8 263..329 CDD:285899
TIL 333..389 CDD:280072
VWC_out 391..>436 CDD:214565
VWD 418..582 CDD:214566
C8 619..700 CDD:214843
TIL 710..756 CDD:280072
TIL 798..859 CDD:280072
VWD 888..1047 CDD:214566
C8 1087..1157 CDD:285899
Mucin2_WxxW 1345..1432 CDD:290069
Mucin2_WxxW 1574..1663 CDD:290069
NUDE_C <1676..1796 CDD:282704
Mucin2_WxxW 1870..1959 CDD:290069
Mucin2_WxxW 2184..2273 CDD:290069
Mucin2_WxxW 2498..2587 CDD:290069
Mucin2_WxxW 2687..2776 CDD:290069
Herpes_BLLF1 <2920..3410 CDD:282904
Mucin2_WxxW 3066..3155 CDD:290069
Mucin2_WxxW 3380..3469 CDD:290069
PHA03255 3475..>3621 CDD:165513
Mucin2_WxxW 3625..3713 CDD:290069
Mucin2_WxxW 3779..3867 CDD:290069
VWD 4111..4283 CDD:214566
C8 4336..4398 CDD:285899
VWC 4570..4631 CDD:214564
CT 4708..4790 CDD:214482 29/89 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S12596
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.