DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Burs and Muc19

DIOPT Version :10

Sequence 1:NP_650983.1 Gene:Burs / 42560 FlyBaseID:FBgn0038901 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_997126.2 Gene:Muc19 / 239611 MGIID:2676278 Length:7524 Species:Mus musculus


Alignment Length:121 Identity:29/121 - (23%)
Similarity:55/121 - (45%) Gaps:11/121 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LVSILKLCTAQ----PDSSVAATDNDITHLGDDCQVTPVIHVLQYPGCVPKPIPSFACVGRCASY 83
            ||::::.|..|    .:..:..::.......:||:.|||...::|.|| .|.:....|:|.|...
Mouse  7402 LVAVVQDCPKQTWCAEEERIYDSNKCCYKCKNDCRTTPVNVTVKYNGC-RKRVEMARCIGECKRS 7465

  Fly    84 IQVSGSKIWQMERSCMCCQESGEREAAVSLFCPKVKPGERKFKKVLTKAPLECMCR 139
            ::.: .:.:|:|.||.||:|.......::|.|........:::...|     |.||
Mouse  7466 VKYN-YETFQLENSCSCCREENYEFRDIALECSDGSTIPYRYRHTTT-----CSCR 7515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BursNP_650983.1 None
Muc19NP_997126.2 von Willebrand factor type D domain 47..198
VWD 52..192 CDD:214566
TIL 298..353 CDD:410995
trypsin inhibitor like cysteine rich domain 298..320
von Willebrand factor type D domain 383..545
VWD 383..545 CDD:214566
C8 584..650 CDD:462584
TIL 654..711 CDD:410995
TIL 753..813 CDD:410995
von Willebrand factor type D domain 842..1005
VWD 842..1003 CDD:214566
C8 1041..1115 CDD:214843
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1244..7217
Approximate repeats 1321..7188
FhaB 1444..3128 CDD:442443
FhaB 3237..4921 CDD:442443
Hia 4704..>5322 CDD:444098
FhaB 5614..7243 CDD:442443
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 7249..7297
von Willebrand factor type C domain 7309..7364
VWC 7309..7364 CDD:214564
C-terminal cystine knot-like domain 7437..7519 23/86 (27%)
CT 7437..7519 CDD:214482 23/86 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.